Sotrovimab / 7tm0

A4DAB245_7tm0_L_M | Source PDB: 7tm0 | Chains: L, M | Done
99.57
Yes
10 Å
Yes
Avg A4D Score
-0.7191
Max Score
2.2897
Min Score
-3.8504
Total Score
-163.95
Score CDR
-0.1778
Score non-CDR
-0.8871

Calculation Parameters

Chain Sequence(s) QVQLVQSGAEVKKPGASVKVSCKASGYPFTSYGISWVRQAPGQGLEWMGWISTYNGNTNYAQKFQGRVTMTTDTSTTTGYMELRRLRSDDTAVYYCARDYTRGAWFGESLIGGFDNWGQGTLVTVSSIVLTQSPGTLPGERATLSCRASQTVSSTSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQHDTSLTFGGGTKVE input.pdb
Selected Chain(s) L (Heavy), M (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.8504
Maximum Score 2.2897
Average Score -0.7191
Total Score -163.9525

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q L -1.4079 Soluble
2 V L -0.9857 Soluble
3 Q L -1.2571 Soluble
4 L L 0.0000 Buried
5 V L 0.1673 Aggregation-prone
6 Q L -0.2416 Soluble
7 S L -0.6389 Soluble
8 G L -0.5518 Soluble
9 A L 0.1620 Aggregation-prone
11 E L -0.1186 Soluble
12 V L 0.9039 Aggregation-prone
13 K L -0.9743 Soluble
14 K L -2.3307 Soluble
15 P L -2.7283 Soluble
16 G L -2.2996 Soluble
17 A L -1.8559 Soluble
18 S L -2.5482 Soluble
19 V L 0.0000 Buried
20 K L -2.1743 Soluble
21 V L 0.0000 Buried
22 S L -0.5345 Soluble
23 C L 0.0000 Buried
24 K L -0.7930 Soluble
25 A L 0.0000 Buried
26 S L -0.7570 Soluble
27 G L -0.9591 Soluble
28 Y L -0.4477 Soluble
29 P L -0.2584 Soluble
30 F L 0.0000 Buried
35 T L 0.2094 Aggregation-prone
36 S L 0.3735 Aggregation-prone
37 Y L 0.5640 Aggregation-prone
38 G L 0.0000 Buried
39 I L 0.0000 Buried
40 S L 0.0000 Buried
41 W L 0.0000 Buried
42 V L 0.0000 Buried
43 R L 0.0000 Buried
44 Q L -0.7888 Soluble
45 A L -1.0498 Soluble
46 P L -0.8591 Soluble
47 G L -1.2190 Soluble
48 Q L -1.8677 Soluble
49 G L -1.3062 Soluble
50 L L 0.0000 Buried
51 E L -1.6788 Soluble
52 W L -0.8109 Soluble
53 M L 0.0000 Buried
54 G L 0.0000 Buried
55 W L 0.0000 Buried
56 I L 0.0000 Buried
57 S L 0.0000 Buried
58 T L 0.0000 Buried
59 Y L 0.2845 Aggregation-prone
62 N L -1.0480 Soluble
63 G L -1.4626 Soluble
64 N L -1.6985 Soluble
65 T L -1.3913 Soluble
66 N L -1.4912 Soluble
67 Y L -1.2988 Soluble
68 A L 0.0000 Buried
69 Q L -2.6881 Soluble
70 K L -2.9220 Soluble
71 F L -2.4380 Soluble
72 Q L -2.7867 Soluble
74 G L -2.6497 Soluble
75 R L -3.5705 Soluble
76 V L 0.0000 Buried
77 T L -1.1666 Soluble
78 M L 0.0000 Buried
79 T L -0.5028 Soluble
80 T L -0.6022 Soluble
81 D L -1.0768 Soluble
82 T L -0.5482 Soluble
83 S L -0.5715 Soluble
84 T L -0.6372 Soluble
85 T L -0.6911 Soluble
86 T L 0.0000 Buried
87 G L 0.0000 Buried
88 Y L -0.5174 Soluble
89 M L 0.0000 Buried
90 E L -1.7901 Soluble
91 L L 0.0000 Buried
92 R L -3.8111 Soluble
93 R L -3.8504 Soluble
94 L L 0.0000 Buried
95 R L -3.7563 Soluble
96 S L -2.5019 Soluble
97 D L -2.6855 Soluble
98 D L -2.0286 Soluble
99 T L -0.8222 Soluble
100 A L 0.0000 Buried
101 V L 0.4038 Aggregation-prone
102 Y L 0.0000 Buried
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 A L 0.0000 Buried
106 R L 0.0000 Buried
107 D L 0.0000 Buried
108 Y L 0.9773 Aggregation-prone
109 T L 0.0000 Buried
110 R L 0.0678 Aggregation-prone
111 G L 0.3738 Aggregation-prone
111A A L 0.0000 Buried
111B W L 1.4491 Aggregation-prone
111C F L 1.4983 Aggregation-prone
112D G L -0.5222 Soluble
112C E L -1.3178 Soluble
112B S L -0.5298 Soluble
112A L L 0.8675 Aggregation-prone
112 I L 2.2897 Aggregation-prone
113 G L 0.0000 Buried
114 G L 0.0000 Buried
115 F L 0.0000 Buried
116 D L -1.1204 Soluble
117 N L -1.0950 Soluble
118 W L -0.9657 Soluble
119 G L 0.0000 Buried
120 Q L -1.3275 Soluble
121 G L -0.4752 Soluble
122 T L 0.0000 Buried
123 L L 0.7644 Aggregation-prone
124 V L 0.0000 Buried
125 T L -0.2522 Soluble
126 V L 0.0000 Buried
127 S L -1.2006 Soluble
128 S L -0.7557 Soluble
2 I M 0.6652 Aggregation-prone
3 V M 1.3271 Aggregation-prone
4 L M 0.0000 Buried
5 T M -0.5171 Soluble
6 Q M -0.8962 Soluble
7 S M -0.8192 Soluble
8 P M -0.4409 Soluble
9 G M -0.6893 Soluble
10 T M -0.6263 Soluble
11 L M -0.1848 Soluble
15 P M -2.3219 Soluble
16 G M -2.5698 Soluble
17 E M -3.6662 Soluble
18 R M -3.6895 Soluble
19 A M 0.0000 Buried
20 T M -0.4441 Soluble
21 L M 0.0000 Buried
22 S M -1.0170 Soluble
23 C M 0.0000 Buried
24 R M -2.5893 Soluble
25 A M 0.0000 Buried
26 S M -0.7723 Soluble
27 Q M -1.5161 Soluble
28 T M -1.4492 Soluble
29 V M 0.0000 Buried
30 S M -0.7741 Soluble
36 S M -0.2686 Soluble
37 T M 0.3947 Aggregation-prone
38 S M 0.0000 Buried
39 L M 0.0000 Buried
40 A M 0.0000 Buried
41 W M 0.0000 Buried
42 Y M 0.0000 Buried
43 Q M 0.0000 Buried
44 Q M -1.3510 Soluble
45 K M -2.0095 Soluble
46 P M -1.2471 Soluble
47 G M -1.5830 Soluble
48 Q M -2.3368 Soluble
49 A M -1.6943 Soluble
50 P M 0.0000 Buried
51 R M -2.3430 Soluble
52 L M 0.0000 Buried
53 L M 0.0000 Buried
54 I M 0.0000 Buried
55 Y M 0.3760 Aggregation-prone
56 G M 0.4229 Aggregation-prone
57 A M 0.0000 Buried
65 S M -0.5415 Soluble
66 S M -0.3419 Soluble
67 R M -1.1963 Soluble
68 A M -0.8320 Soluble
69 T M -0.5697 Soluble
70 G M -0.7739 Soluble
71 I M -1.0301 Soluble
72 P M -1.3393 Soluble
74 D M -2.2561 Soluble
75 R M -2.1349 Soluble
76 F M 0.0000 Buried
77 S M -0.8837 Soluble
78 G M 0.0000 Buried
79 S M -0.7179 Soluble
80 G M -1.3372 Soluble
83 S M -1.1143 Soluble
84 G M -1.4330 Soluble
85 T M -2.0936 Soluble
86 D M -2.8850 Soluble
87 F M 0.0000 Buried
88 T M -0.9318 Soluble
89 L M 0.0000 Buried
90 T M -0.7978 Soluble
91 I M 0.0000 Buried
92 S M -2.5551 Soluble
93 R M -3.6701 Soluble
94 L M 0.0000 Buried
95 E M -2.7953 Soluble
96 P M -1.8037 Soluble
97 E M -2.3303 Soluble
98 D M 0.0000 Buried
99 F M -1.0983 Soluble
100 A M 0.0000 Buried
101 V M -0.3015 Soluble
102 Y M 0.0000 Buried
103 Y M 0.0000 Buried
104 C M 0.0000 Buried
105 Q M 0.0000 Buried
106 Q M 0.0000 Buried
107 H M 0.0000 Buried
108 D M -1.4015 Soluble
114 T M -0.8082 Soluble
115 S M -0.6906 Soluble
116 L M 0.0000 Buried
117 T M -0.0743 Soluble
118 F M 0.0000 Buried
119 G M 0.0000 Buried
120 G M -0.8190 Soluble
121 G M -0.7352 Soluble
122 T M 0.0000 Buried
123 K M -0.7428 Soluble
124 V M 0.0000 Buried
125 E M -1.6319 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6461 5.2733 CSV PDB
4.5 -0.6902 5.1674 CSV PDB
5.0 -0.7412 5.0586 CSV PDB
5.5 -0.7908 4.9913 CSV PDB
6.0 -0.8314 4.9314 CSV PDB
6.5 -0.8574 4.889 CSV PDB
7.0 -0.8682 4.8669 CSV PDB
7.5 -0.8686 4.858 CSV PDB
8.0 -0.8623 4.8548 CSV PDB
8.5 -0.8501 4.8538 CSV PDB
9.0 -0.8315 4.8531 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH