Zanidatamab / 4llw

A4DAB304_4llw_C_D | Source PDB: 4llw | Chains: C, D | Done
97.35
Yes
10 Å
Yes
Avg A4D Score
-0.6745
Max Score
1.86
Min Score
-3.2183
Total Score
-285.31
Score CDR
-0.2087
Score non-CDR
-0.7313

Calculation Parameters

Chain Sequence(s) EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRYAPGKGLEWVADVNPNSGGSIYNQRFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKDIQMTQSPSSLSASVGDRVTITCKASQDVSIGVAWYQRKPGKAPKLLIYSASYRYTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYIYPYTFGQGTKVEIKGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP input.pdb
Selected Chain(s) C (Heavy), D (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.2183
Maximum Score 1.86
Average Score -0.6745
Total Score -285.3143

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E C -2.1719 Soluble
2 V C -1.1755 Soluble
3 Q C -1.3316 Soluble
4 L C 0.0000 Buried
5 V C 0.5815 Aggregation-prone
6 E C 0.0000 Buried
7 S C -0.3599 Soluble
8 G C -0.7178 Soluble
9 G C -0.0994 Soluble
11 G C 0.1598 Aggregation-prone
12 L C 0.3483 Aggregation-prone
13 V C -0.5300 Soluble
14 Q C -1.5862 Soluble
15 P C -1.8975 Soluble
16 G C -1.5664 Soluble
17 G C -1.1183 Soluble
18 S C -1.1954 Soluble
19 L C -0.8857 Soluble
20 R C -1.8802 Soluble
21 L C 0.0000 Buried
22 S C -0.3809 Soluble
23 C C 0.0000 Buried
24 A C -0.4731 Soluble
25 A C 0.0000 Buried
26 S C -1.1704 Soluble
27 G C -1.3519 Soluble
28 F C -0.7515 Soluble
29 T C -0.7754 Soluble
30 F C 0.0000 Buried
35 T C -1.6711 Soluble
36 D C -2.0200 Soluble
37 Y C -0.8417 Soluble
38 T C -0.6382 Soluble
39 M C 0.0000 Buried
40 D C 0.0000 Buried
41 W C 0.0000 Buried
42 V C 0.0000 Buried
43 R C -0.2753 Soluble
44 Y C -0.3635 Soluble
45 A C -0.9048 Soluble
46 P C -0.9926 Soluble
47 G C -1.5430 Soluble
48 K C -2.4662 Soluble
49 G C -1.5834 Soluble
50 L C 0.0000 Buried
51 E C -0.8597 Soluble
52 W C 0.0000 Buried
53 V C 0.0000 Buried
54 A C 0.0000 Buried
55 D C 0.0000 Buried
56 V C 0.0000 Buried
57 N C -1.1751 Soluble
58 P C 0.0000 Buried
59 N C -2.0609 Soluble
62 S C -1.2635 Soluble
63 G C -1.1657 Soluble
64 G C -0.6617 Soluble
65 S C 0.1594 Aggregation-prone
66 I C 1.0184 Aggregation-prone
67 Y C -0.0380 Soluble
68 N C 0.0000 Buried
69 Q C -2.7145 Soluble
70 R C -3.2183 Soluble
71 F C 0.0000 Buried
72 K C -2.9480 Soluble
74 G C -1.9914 Soluble
75 R C -1.6412 Soluble
76 F C 0.0000 Buried
77 T C -0.4010 Soluble
78 L C 0.0000 Buried
79 S C -0.6201 Soluble
80 V C -1.3228 Soluble
81 D C -2.8096 Soluble
82 R C -3.0686 Soluble
83 S C -2.3564 Soluble
84 K C -3.0463 Soluble
85 N C -2.5189 Soluble
86 T C 0.0000 Buried
87 L C 0.0000 Buried
88 Y C -0.6013 Soluble
89 L C 0.0000 Buried
90 Q C -1.1204 Soluble
91 M C 0.0000 Buried
92 N C -1.3924 Soluble
93 S C -1.4027 Soluble
94 L C 0.0000 Buried
95 R C -2.9167 Soluble
96 A C -2.0139 Soluble
97 E C -2.5963 Soluble
98 D C 0.0000 Buried
99 T C -0.5772 Soluble
100 A C 0.0000 Buried
101 V C 0.4264 Aggregation-prone
102 Y C 0.0000 Buried
103 Y C 0.0000 Buried
104 C C 0.0000 Buried
105 A C 0.0000 Buried
106 R C 0.0000 Buried
107 N C 0.0000 Buried
108 L C 0.5071 Aggregation-prone
109 G C -0.2254 Soluble
110 P C -0.1322 Soluble
112 S C 0.4257 Aggregation-prone
113 F C 0.7344 Aggregation-prone
114 Y C 0.0000 Buried
115 F C 0.0000 Buried
116 D C -0.0390 Soluble
117 Y C -0.0378 Soluble
118 W C 0.0000 Buried
119 G C 0.0000 Buried
120 Q C -1.4573 Soluble
121 G C -0.4751 Soluble
122 T C 0.3742 Aggregation-prone
123 L C 1.4502 Aggregation-prone
124 V C 0.0000 Buried
125 T C -0.1886 Soluble
126 V C 0.0000 Buried
127 S C -1.0507 Soluble
128 S C -0.8853 Soluble
129 A C -0.4917 Soluble
130 S C -0.5697 Soluble
131 T C -0.6776 Soluble
132 K C -1.1177 Soluble
133 G C -1.3778 Soluble
134 P C -0.5615 Soluble
135 S C -0.1958 Soluble
136 V C 0.0000 Buried
137 F C 0.0000 Buried
138 P C -1.0940 Soluble
139 L C 0.0000 Buried
140 A C -1.2889 Soluble
141 P C 0.0000 Buried
142 S C -0.8331 Soluble
143 G C -0.6274 Soluble
144 T C -0.4212 Soluble
145 A C -0.2547 Soluble
146 A C -0.0816 Soluble
147 L C 0.0000 Buried
148 G C 0.0000 Buried
149 C C 0.0000 Buried
150 L C 0.0000 Buried
151 V C 0.0000 Buried
152 K C 0.0000 Buried
153 D C 0.0000 Buried
154 Y C 0.0000 Buried
155 F C 0.0000 Buried
156 P C -0.8636 Soluble
157 E C -1.2613 Soluble
158 P C -1.2473 Soluble
159 V C 0.0000 Buried
160 T C -0.9496 Soluble
161 V C -0.5804 Soluble
162 S C -0.4871 Soluble
163 W C 0.0000 Buried
164 N C -0.6166 Soluble
165 S C -0.5849 Soluble
166 G C -0.5165 Soluble
167 A C -0.2376 Soluble
168 L C 0.0107 Aggregation-prone
169 T C -0.2252 Soluble
170 S C -0.2328 Soluble
171 G C -0.2362 Soluble
172 V C -0.0758 Soluble
173 H C -0.5206 Soluble
174 T C -0.2371 Soluble
175 F C 0.0000 Buried
176 P C -0.2236 Soluble
177 A C -0.0780 Soluble
178 V C 0.0000 Buried
179 L C 0.5257 Aggregation-prone
180 Q C -0.1836 Soluble
181 S C -0.3886 Soluble
182 S C -0.2521 Soluble
183 G C -0.0803 Soluble
184 L C 0.0371 Aggregation-prone
185 Y C 0.1994 Aggregation-prone
186 S C 0.0000 Buried
187 L C 0.0000 Buried
188 S C 0.0000 Buried
189 S C 0.0000 Buried
190 V C 0.0000 Buried
191 V C 0.0000 Buried
192 T C -0.1990 Soluble
193 V C 0.0000 Buried
194 P C -0.5086 Soluble
195 S C -0.4909 Soluble
196 S C -0.5959 Soluble
197 S C -0.6397 Soluble
198 L C -0.7501 Soluble
199 G C -0.9686 Soluble
200 T C -0.7551 Soluble
201 Q C -1.3103 Soluble
202 T C -1.0024 Soluble
203 Y C 0.0000 Buried
204 I C -0.8213 Soluble
205 C C 0.0000 Buried
206 N C -1.3623 Soluble
207 V C 0.0000 Buried
208 N C -2.5711 Soluble
209 H C 0.0000 Buried
210 K C -3.0730 Soluble
211 P C -1.8288 Soluble
212 S C -1.9419 Soluble
213 N C -2.6935 Soluble
214 T C -2.2793 Soluble
215 K C -2.8240 Soluble
216 V C -1.3551 Soluble
217 D C -1.9224 Soluble
218 K C -1.5457 Soluble
219 K C -1.8851 Soluble
220 V C 0.0000 Buried
221 E C -2.7533 Soluble
222 P C -1.9900 Soluble
223 K C -2.3387 Soluble
1 D D -2.1793 Soluble
2 I D -1.3207 Soluble
3 Q D -1.9787 Soluble
4 M D 0.0000 Buried
5 T D -1.3281 Soluble
6 Q D 0.0000 Buried
7 S D -0.7501 Soluble
8 P D -0.4751 Soluble
9 S D -0.7958 Soluble
10 S D -0.7915 Soluble
11 L D -0.5193 Soluble
12 S D -0.9146 Soluble
13 A D 0.0000 Buried
14 S D -0.3045 Soluble
15 V D 0.4930 Aggregation-prone
16 G D -0.5982 Soluble
17 D D -1.5574 Soluble
18 R D -2.2884 Soluble
19 V D 0.0000 Buried
20 T D -0.6271 Soluble
21 I D 0.0000 Buried
22 T D -0.8801 Soluble
23 C D 0.0000 Buried
24 K D -2.6914 Soluble
25 A D 0.0000 Buried
26 S D -2.1657 Soluble
27 Q D -2.6976 Soluble
28 D D -2.4670 Soluble
29 V D 0.0000 Buried
36 S D -0.3203 Soluble
37 I D 0.8221 Aggregation-prone
38 G D 0.0000 Buried
39 V D 0.0000 Buried
40 A D 0.0000 Buried
41 W D 0.0000 Buried
42 Y D 0.0000 Buried
43 Q D 0.0000 Buried
44 R D 0.0000 Buried
45 K D -1.8493 Soluble
46 P D -1.3226 Soluble
47 G D -1.5333 Soluble
48 K D -2.6620 Soluble
49 A D -1.6949 Soluble
50 P D 0.0000 Buried
51 K D -1.7310 Soluble
52 L D 0.0000 Buried
53 L D 0.0000 Buried
54 I D 0.0000 Buried
55 Y D 0.6880 Aggregation-prone
56 S D 0.8225 Aggregation-prone
57 A D 0.0000 Buried
65 S D 0.3940 Aggregation-prone
66 Y D 0.8434 Aggregation-prone
67 R D -0.3333 Soluble
68 Y D -0.1738 Soluble
69 T D -0.2432 Soluble
70 G D -0.5542 Soluble
71 V D -0.5569 Soluble
72 P D -0.4820 Soluble
74 S D -0.6342 Soluble
75 R D -0.8777 Soluble
76 F D 0.0000 Buried
77 S D -0.3099 Soluble
78 G D 0.0000 Buried
79 S D -0.3363 Soluble
80 G D -0.9081 Soluble
83 S D -0.7587 Soluble
84 G D -1.5763 Soluble
85 T D -2.2287 Soluble
86 D D -2.7329 Soluble
87 F D 0.0000 Buried
88 T D -0.8165 Soluble
89 L D 0.0000 Buried
90 T D -0.5803 Soluble
91 I D 0.0000 Buried
92 S D -1.2926 Soluble
93 S D -1.1046 Soluble
94 L D 0.0000 Buried
95 Q D -0.9132 Soluble
96 P D -0.7560 Soluble
97 E D -1.8372 Soluble
98 D D 0.0000 Buried
99 F D -0.4873 Soluble
100 A D 0.0000 Buried
101 T D -0.8799 Soluble
102 Y D 0.0000 Buried
103 Y D 0.0000 Buried
104 C D 0.0000 Buried
105 Q D 0.0000 Buried
106 Q D 0.0000 Buried
107 Y D 1.4520 Aggregation-prone
108 Y D 1.8517 Aggregation-prone
109 I D 1.8600 Aggregation-prone
114 Y D 1.2355 Aggregation-prone
115 P D 0.1444 Aggregation-prone
116 Y D 0.5219 Aggregation-prone
117 T D -0.2362 Soluble
118 F D 0.0000 Buried
119 G D 0.0000 Buried
120 Q D -1.6736 Soluble
121 G D 0.0000 Buried
122 T D 0.0000 Buried
123 K D -1.4213 Soluble
124 V D 0.0000 Buried
125 E D -0.8648 Soluble
126 I D -0.4326 Soluble
127 K D -1.7318 Soluble
128 G D -1.9389 Soluble
129 Q D -2.0745 Soluble
130 P D -1.5384 Soluble
131 K D -1.5009 Soluble
132 A D -1.1169 Soluble
133 A D -0.6480 Soluble
134 P D 0.0000 Buried
135 S D -0.5727 Soluble
136 V D 0.0000 Buried
137 T D -0.4776 Soluble
138 L D 0.0000 Buried
139 F D 0.0000 Buried
140 P D -0.0733 Soluble
141 P D 0.0000 Buried
142 S D -1.1699 Soluble
143 S D -1.7655 Soluble
144 E D -2.4459 Soluble
145 E D 0.0000 Buried
146 L D -2.1437 Soluble
147 Q D -2.3358 Soluble
148 A D -1.8114 Soluble
149 N D -2.4989 Soluble
150 K D -2.1963 Soluble
151 A D 0.0000 Buried
152 T D 0.0000 Buried
153 L D 0.0000 Buried
154 V D 0.0000 Buried
155 C D 0.0000 Buried
156 L D 0.0000 Buried
157 I D 0.0000 Buried
158 S D -0.5194 Soluble
159 D D -1.1969 Soluble
160 F D 0.0000 Buried
161 Y D 0.0000 Buried
162 P D -1.1116 Soluble
163 G D -0.2284 Soluble
164 A D -0.1652 Soluble
165 V D 0.0373 Aggregation-prone
166 T D 0.0082 Aggregation-prone
167 V D 0.0989 Aggregation-prone
168 A D -0.4871 Soluble
169 W D 0.0000 Buried
170 K D -1.1386 Soluble
171 A D -1.0055 Soluble
172 D D -1.2817 Soluble
173 S D -0.8577 Soluble
174 S D -0.7881 Soluble
175 P D -0.9214 Soluble
176 V D -0.8855 Soluble
177 K D -1.7315 Soluble
178 A D -0.8830 Soluble
179 G D -0.7858 Soluble
180 V D -0.5273 Soluble
181 E D -0.7596 Soluble
182 T D -0.1883 Soluble
183 T D 0.0000 Buried
184 T D -0.1715 Soluble
185 P D -0.2106 Soluble
186 S D -0.4543 Soluble
187 K D -1.0019 Soluble
188 Q D -1.2086 Soluble
189 S D -1.1716 Soluble
190 N D -1.8536 Soluble
191 N D -1.8872 Soluble
192 K D -1.7045 Soluble
193 Y D -0.7769 Soluble
194 A D 0.0000 Buried
195 A D 0.0000 Buried
196 S D 0.0000 Buried
197 S D 0.0000 Buried
198 Y D 0.0000 Buried
199 L D 0.0000 Buried
200 S D -0.5374 Soluble
201 L D 0.0000 Buried
202 T D -1.6899 Soluble
203 P D -2.3517 Soluble
204 E D -3.1091 Soluble
205 Q D -2.5201 Soluble
206 W D 0.0000 Buried
207 K D -3.1036 Soluble
208 S D -2.4400 Soluble
209 H D -2.4444 Soluble
210 R D -2.6006 Soluble
211 S D -1.6021 Soluble
212 Y D 0.0000 Buried
213 S D 0.0000 Buried
214 C D 0.0000 Buried
215 Q D -1.1771 Soluble
216 V D 0.0000 Buried
217 T D -0.6295 Soluble
218 H D 0.0000 Buried
219 E D -2.1133 Soluble
220 G D -1.3858 Soluble
221 S D -0.8433 Soluble
222 T D -0.7281 Soluble
223 V D -0.8225 Soluble
224 E D -2.2268 Soluble
225 K D -1.7384 Soluble
226 T D -0.9486 Soluble
227 V D -0.3467 Soluble
228 A D -0.8596 Soluble
229 P D -1.1465 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6461 2.7031 CSV PDB
4.5 -0.6805 2.6533 CSV PDB
5.0 -0.7215 2.6017 CSV PDB
5.5 -0.76 2.5496 CSV PDB
6.0 -0.7857 2.4973 CSV PDB
6.5 -0.7903 2.4454 CSV PDB
7.0 -0.7741 2.3944 CSV PDB
7.5 -0.7447 2.3462 CSV PDB
8.0 -0.7088 2.3051 CSV PDB
8.5 -0.6686 2.2763 CSV PDB
9.0 -0.6245 2.2597 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH