Anivovetmab / 3iy6

A4DAB019_3iy6_B_A | Source PDB: 3iy6 | Chains: B, A | Done
98.19
Yes
10 Å
Yes
Avg A4D Score
-0.5751
Max Score
1.7657
Min Score
-3.0833
Total Score
-127.67
Score CDR
-0.525
Score non-CDR
-0.5893

Calculation Parameters

Chain Sequence(s) SGPGLVQPSQTLSLTCTVSGFSLSSYHVHWVRQPPGKGLEWLGVMWNDGDTSYNLALNSRLSISRDTSKSQVFFKMSSLQTEDTATYYCARPELPGLTYGVWFPYWGQGTLVTVSLMTQIPASMSISVGDRVTMNCKASQNVDSNVDWYQQKTGQSPNLLIYKASNRNTGVPDRFTGSGSGTDFTFTISNMQAEDLAVYYCMQSTSYPLTFGSGTKLEIKRA input.pdb
Selected Chain(s) B (Heavy), A (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.0833
Maximum Score 1.7657
Average Score -0.5751
Total Score -127.6735

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
7 S B -0.2957 Soluble
8 G B -0.2499 Soluble
9 P B 0.4080 Aggregation-prone
11 G B 0.8675 Aggregation-prone
12 L B 1.2986 Aggregation-prone
13 V B 0.0000 Buried
14 Q B -1.3253 Soluble
15 P B -1.3502 Soluble
16 S B -1.1345 Soluble
17 Q B -0.9921 Soluble
18 T B -0.8440 Soluble
19 L B -0.2979 Soluble
20 S B -0.5339 Soluble
21 L B 0.0000 Buried
22 T B -0.2011 Soluble
23 C B 0.0000 Buried
24 T B -0.3607 Soluble
25 V B 0.0000 Buried
26 S B -0.3725 Soluble
27 G B -0.4338 Soluble
28 F B -0.0153 Soluble
29 S B -0.4194 Soluble
30 L B 0.0000 Buried
35 S B -0.7253 Soluble
36 S B -0.4201 Soluble
37 Y B -0.1958 Soluble
38 H B 0.0000 Buried
39 V B 0.0000 Buried
40 H B 0.0000 Buried
41 W B 0.0000 Buried
42 V B 0.0000 Buried
43 R B 0.0000 Buried
44 Q B 0.0000 Buried
45 P B -1.1700 Soluble
46 P B -0.9584 Soluble
47 G B -1.4687 Soluble
48 K B -2.1945 Soluble
49 G B -1.4087 Soluble
50 L B -0.9206 Soluble
51 E B -1.0875 Soluble
52 W B 0.0000 Buried
53 L B 0.0000 Buried
54 G B 0.0000 Buried
55 V B 0.0000 Buried
56 M B 0.0000 Buried
57 W B -1.6887 Soluble
58 N B -2.5174 Soluble
59 D B -3.0833 Soluble
63 G B -2.5889 Soluble
64 D B -2.6877 Soluble
65 T B -1.3380 Soluble
66 S B -0.4537 Soluble
67 Y B -0.0618 Soluble
68 N B -0.0834 Soluble
69 L B 0.9080 Aggregation-prone
70 A B 0.0403 Aggregation-prone
71 L B 0.0000 Buried
72 N B -0.6231 Soluble
74 S B -0.6151 Soluble
75 R B -0.7558 Soluble
76 L B 0.0000 Buried
77 S B -0.6102 Soluble
78 I B 0.0000 Buried
79 S B -0.4116 Soluble
80 R B -0.8513 Soluble
81 D B -1.2019 Soluble
82 T B -1.1055 Soluble
83 S B -1.3427 Soluble
84 K B -2.0859 Soluble
85 S B -1.2906 Soluble
86 Q B -0.9138 Soluble
87 V B 0.0000 Buried
88 F B -0.0389 Soluble
89 F B 0.0000 Buried
90 K B -0.9394 Soluble
91 M B 0.0000 Buried
92 S B -0.8179 Soluble
93 S B -0.8724 Soluble
94 L B 0.0000 Buried
95 Q B -1.8003 Soluble
96 T B -1.5991 Soluble
97 E B -2.1303 Soluble
98 D B 0.0000 Buried
99 T B -0.3995 Soluble
100 A B 0.0000 Buried
101 T B 0.1889 Aggregation-prone
102 Y B 0.0000 Buried
103 Y B 0.0000 Buried
104 C B 0.0000 Buried
105 A B 0.0000 Buried
106 R B -0.4128 Soluble
107 P B 0.0000 Buried
108 E B -0.9090 Soluble
109 L B 0.0000 Buried
110 P B 0.2602 Aggregation-prone
111 G B 0.8081 Aggregation-prone
111A L B 1.7657 Aggregation-prone
112B T B 1.0648 Aggregation-prone
112A Y B 1.1295 Aggregation-prone
112 G B 0.0000 Buried
113 V B 0.0000 Buried
114 W B -0.3871 Soluble
115 F B 0.0000 Buried
116 P B -0.4447 Soluble
117 Y B -0.3527 Soluble
118 W B -0.1886 Soluble
119 G B -0.5469 Soluble
120 Q B -1.4478 Soluble
121 G B -0.5491 Soluble
122 T B 0.2295 Aggregation-prone
123 L B 1.5205 Aggregation-prone
124 V B 0.0000 Buried
125 T B 0.3204 Aggregation-prone
126 V B 0.0000 Buried
127 S B -0.7432 Soluble
3 L A 1.1677 Aggregation-prone
4 M A 0.1493 Aggregation-prone
5 T A 0.0912 Aggregation-prone
6 Q A 0.3349 Aggregation-prone
7 I A 1.6067 Aggregation-prone
8 P A 0.9440 Aggregation-prone
9 A A 0.4225 Aggregation-prone
10 S A -0.3570 Soluble
11 M A -0.4387 Soluble
12 S A -1.3652 Soluble
13 I A 0.0000 Buried
14 S A -1.5522 Soluble
15 V A -0.7608 Soluble
16 G A -1.3043 Soluble
17 D A -2.1788 Soluble
18 R A -2.7547 Soluble
19 V A 0.0000 Buried
20 T A -0.3406 Soluble
21 M A 0.0000 Buried
22 N A -0.3826 Soluble
23 C A 0.0000 Buried
24 K A -1.4754 Soluble
25 A A 0.0000 Buried
26 S A -0.9616 Soluble
27 Q A -2.1715 Soluble
28 N A -2.7956 Soluble
29 V A 0.0000 Buried
36 D A -2.6089 Soluble
37 S A -1.7151 Soluble
38 N A 0.0000 Buried
39 V A 0.0000 Buried
40 D A 0.0000 Buried
41 W A 0.0000 Buried
42 Y A 0.0000 Buried
43 Q A 0.0000 Buried
44 Q A -1.2193 Soluble
45 K A -1.4037 Soluble
46 T A -0.8240 Soluble
47 G A -1.2585 Soluble
48 Q A -2.0839 Soluble
49 S A -1.4788 Soluble
50 P A 0.0000 Buried
51 N A -1.4918 Soluble
52 L A 0.0000 Buried
53 L A 0.0000 Buried
54 I A 0.0000 Buried
55 Y A -1.1899 Soluble
56 K A -2.0695 Soluble
57 A A 0.0000 Buried
65 S A -1.3346 Soluble
66 N A -1.6093 Soluble
67 R A -1.7174 Soluble
68 N A -1.2755 Soluble
69 T A -0.5873 Soluble
70 G A -0.7910 Soluble
71 V A -0.9304 Soluble
72 P A -1.2377 Soluble
74 D A -2.3015 Soluble
75 R A -1.9471 Soluble
76 F A 0.0000 Buried
77 T A -0.9224 Soluble
78 G A 0.0000 Buried
79 S A -0.9337 Soluble
80 G A -1.2595 Soluble
83 S A -1.4456 Soluble
84 G A -1.9400 Soluble
85 T A -2.0908 Soluble
86 D A -2.1046 Soluble
87 F A 0.0000 Buried
88 T A -0.5431 Soluble
89 F A 0.0000 Buried
90 T A -0.7938 Soluble
91 I A 0.0000 Buried
92 S A -2.2383 Soluble
93 N A -2.5513 Soluble
94 M A 0.0000 Buried
95 Q A -1.2524 Soluble
96 A A -1.0081 Soluble
97 E A -1.4975 Soluble
98 D A 0.0000 Buried
99 L A -0.5467 Soluble
100 A A 0.0000 Buried
101 V A -0.5475 Soluble
102 Y A 0.0000 Buried
103 Y A 0.0000 Buried
104 C A 0.0000 Buried
105 M A 0.0000 Buried
106 Q A 0.0000 Buried
107 S A 0.0000 Buried
108 T A -0.3247 Soluble
109 S A 0.1907 Aggregation-prone
114 Y A 0.1676 Aggregation-prone
115 P A 0.2716 Aggregation-prone
116 L A 0.0000 Buried
117 T A 0.2555 Aggregation-prone
118 F A 0.0000 Buried
119 G A 0.0000 Buried
120 S A -0.3649 Soluble
121 G A -0.2449 Soluble
122 T A 0.0000 Buried
123 K A -0.9287 Soluble
124 L A 0.0000 Buried
125 E A -2.1499 Soluble
126 I A -1.8469 Soluble
127 K A -2.6556 Soluble
128 R A -2.5646 Soluble
129 A A -1.1495 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.5453 2.8151 CSV PDB
4.5 -0.5831 2.8151 CSV PDB
5.0 -0.6268 2.8151 CSV PDB
5.5 -0.669 2.8151 CSV PDB
6.0 -0.7018 2.8151 CSV PDB
6.5 -0.7193 2.8151 CSV PDB
7.0 -0.7214 2.8151 CSV PDB
7.5 -0.7127 2.815 CSV PDB
8.0 -0.6972 2.8149 CSV PDB
8.5 -0.6756 2.855 CSV PDB
9.0 -0.6468 2.8991 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH