Diridavumab / 3gbn

A4DAB087_3gbn_H_L | Source PDB: 3gbn | Chains: H, L | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.4413
Max Score
3.1629
Min Score
-2.9954
Total Score
-137.24
Score CDR
-0.1548
Score non-CDR
-0.5001

Calculation Parameters

Chain Sequence(s) EVQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSSASTKGPSVFPLGCLVKDYFPEPVTTFPAVLQSSGLYSLSVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRRPTAYVVFGGGTKLTVLEELQANKATLVCLISDFYGVETTTPSKQSNNKYAASSYLSCQ input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.9954
Maximum Score 3.1629
Average Score -0.4413
Total Score -137.244

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E H -2.0379 Soluble
2 V H -1.2489 Soluble
3 Q H -1.5489 Soluble
4 L H 0.0000 Buried
5 V H 0.5960 Aggregation-prone
6 E H 0.0000 Buried
7 S H -0.4079 Soluble
8 G H -0.4483 Soluble
9 A H -0.2574 Soluble
11 E H -0.5699 Soluble
12 V H 0.2240 Aggregation-prone
13 K H -0.9597 Soluble
14 K H -1.6267 Soluble
15 P H -1.9863 Soluble
16 G H -1.4411 Soluble
17 S H -1.0777 Soluble
18 S H -1.3423 Soluble
19 V H 0.0000 Buried
20 K H -2.1994 Soluble
21 V H 0.0000 Buried
22 S H -0.6061 Soluble
23 C H 0.0000 Buried
24 K H -1.2633 Soluble
25 A H -0.6557 Soluble
26 S H -0.9870 Soluble
27 G H -1.0862 Soluble
28 G H -0.0413 Soluble
29 P H 0.2319 Aggregation-prone
30 F H 1.7355 Aggregation-prone
35 R H 0.8907 Aggregation-prone
36 S H 0.7530 Aggregation-prone
37 Y H 0.9854 Aggregation-prone
38 A H 0.0000 Buried
39 I H 0.0000 Buried
40 S H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H 0.0000 Buried
44 Q H -0.6263 Soluble
45 A H -1.0295 Soluble
46 P H -1.1080 Soluble
47 G H -1.2350 Soluble
48 Q H -1.7413 Soluble
49 G H -1.1525 Soluble
50 P H 0.0000 Buried
51 E H -0.9149 Soluble
52 W H 0.0000 Buried
53 M H 0.0000 Buried
54 G H 0.0000 Buried
55 G H 0.0000 Buried
56 I H 0.0000 Buried
57 I H 1.1239 Aggregation-prone
58 P H 0.0000 Buried
59 I H 3.1629 Aggregation-prone
62 F H 2.9541 Aggregation-prone
63 G H 1.1576 Aggregation-prone
64 T H 0.4847 Aggregation-prone
65 T H -0.2002 Soluble
66 K H -0.8057 Soluble
67 Y H -0.8417 Soluble
68 A H 0.0000 Buried
69 P H -1.3747 Soluble
70 K H -2.1290 Soluble
71 F H 0.0000 Buried
72 Q H -1.7550 Soluble
74 G H -1.3132 Soluble
75 R H -1.2839 Soluble
76 V H 0.0000 Buried
77 T H -0.9251 Soluble
78 I H 0.0000 Buried
79 T H -0.4086 Soluble
80 A H -0.2618 Soluble
81 D H -0.4402 Soluble
82 D H 0.2209 Aggregation-prone
83 F H 1.6018 Aggregation-prone
84 A H 0.3431 Aggregation-prone
85 G H -0.1963 Soluble
86 T H 0.0000 Buried
87 V H 0.0000 Buried
88 Y H -0.7348 Soluble
89 M H 0.0000 Buried
90 E H -1.7694 Soluble
91 L H 0.0000 Buried
92 S H -1.2000 Soluble
93 S H -1.0873 Soluble
94 L H 0.0000 Buried
95 R H -2.9954 Soluble
96 S H -2.3028 Soluble
97 E H -2.5682 Soluble
98 D H 0.0000 Buried
99 T H -1.0376 Soluble
100 A H 0.0000 Buried
101 M H 0.0320 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 K H 0.0000 Buried
107 H H 0.0000 Buried
108 M H 0.5060 Aggregation-prone
109 G H 0.4216 Aggregation-prone
110 Y H 1.4001 Aggregation-prone
111 Q H -0.2271 Soluble
112A V H 0.0000 Buried
112 R H -0.2877 Soluble
113 E H 0.0000 Buried
114 T H 0.0000 Buried
115 M H 0.0000 Buried
116 D H -0.3601 Soluble
117 V H -0.6764 Soluble
118 W H -0.4227 Soluble
119 G H 0.0000 Buried
120 K H -1.4482 Soluble
121 G H 0.0000 Buried
122 T H 0.0000 Buried
123 T H 0.0007 Aggregation-prone
124 V H 0.0000 Buried
125 T H -0.5244 Soluble
126 V H 0.0000 Buried
127 S H -1.1190 Soluble
128 S H -0.9197 Soluble
129 A H -0.6515 Soluble
130 S H -0.7990 Soluble
131 T H -1.1892 Soluble
132 K H -2.1645 Soluble
133 G H -1.5387 Soluble
134 P H -0.5913 Soluble
135 S H 0.2112 Aggregation-prone
136 V H 1.5510 Aggregation-prone
137 F H 1.0837 Aggregation-prone
138 P H 0.6952 Aggregation-prone
139 L H 1.4066 Aggregation-prone
140 G H 0.3344 Aggregation-prone
141 C H 1.0966 Aggregation-prone
142 L H 0.0000 Buried
143 V H 0.8040 Aggregation-prone
144 K H -0.1084 Soluble
145 D H -0.5764 Soluble
146 Y H 0.0000 Buried
147 F H 0.0000 Buried
148 P H -1.2647 Soluble
149 E H -1.6310 Soluble
150 P H -0.3526 Soluble
151 V H 1.2680 Aggregation-prone
152 T H 0.5367 Aggregation-prone
153 T H 0.1302 Aggregation-prone
154 F H 0.4894 Aggregation-prone
155 P H 0.0208 Aggregation-prone
156 A H 0.2706 Aggregation-prone
157 V H 0.0000 Buried
158 L H 0.9707 Aggregation-prone
159 Q H 0.2484 Aggregation-prone
160 S H -0.0626 Soluble
161 S H -0.2172 Soluble
162 G H -0.0107 Soluble
163 L H -0.3899 Soluble
164 Y H -0.0427 Soluble
165 S H 0.0000 Buried
166 L H 0.5649 Aggregation-prone
167 S H 0.0000 Buried
3 V L 1.5969 Aggregation-prone
4 L L 0.0000 Buried
5 T L -0.0144 Soluble
6 Q L -0.5127 Soluble
7 P L -0.6703 Soluble
8 P L -0.9654 Soluble
9 S L -0.9723 Soluble
11 V L -0.4217 Soluble
12 S L -0.3684 Soluble
13 A L 0.0000 Buried
14 A L -0.5441 Soluble
15 P L -1.1292 Soluble
16 G L -1.7965 Soluble
17 Q L -2.4026 Soluble
18 K L -2.5165 Soluble
19 V L -0.9412 Soluble
20 T L -0.4154 Soluble
21 I L 0.0000 Buried
22 S L -0.3674 Soluble
23 C L 0.0000 Buried
24 S L -0.2967 Soluble
25 G L -0.0692 Soluble
26 S L -0.3623 Soluble
27 S L -1.2177 Soluble
28 S L -1.6921 Soluble
29 N L 0.0000 Buried
30 I L 0.0000 Buried
35 G L -1.0243 Soluble
36 N L -1.5217 Soluble
37 D L 0.0000 Buried
38 Y L 0.2809 Aggregation-prone
39 V L 0.0000 Buried
40 S L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L -0.6092 Soluble
44 Q L -0.7966 Soluble
45 L L -0.4276 Soluble
46 P L -0.5069 Soluble
47 G L -0.7438 Soluble
48 T L -0.7655 Soluble
49 A L 0.0000 Buried
50 P L 0.0000 Buried
51 K L -0.8598 Soluble
52 L L 0.0000 Buried
53 L L 0.0000 Buried
54 I L 0.0000 Buried
55 Y L -0.9742 Soluble
56 D L -0.9699 Soluble
57 N L -1.3061 Soluble
65 N L -2.3471 Soluble
66 K L -2.6880 Soluble
67 R L -2.3000 Soluble
68 P L -1.1290 Soluble
69 S L -0.7596 Soluble
70 G L -0.7955 Soluble
71 I L -1.0172 Soluble
72 P L -1.3460 Soluble
74 D L -2.3680 Soluble
75 R L -1.5284 Soluble
76 F L 0.0000 Buried
77 S L -1.5375 Soluble
78 G L -1.2949 Soluble
79 S L -1.1672 Soluble
80 K L -0.9759 Soluble
83 S L -0.7809 Soluble
84 G L -1.0258 Soluble
85 T L -0.8606 Soluble
86 S L -0.6791 Soluble
87 A L 0.0000 Buried
88 T L -0.6034 Soluble
89 L L 0.0000 Buried
90 G L -0.5744 Soluble
91 I L 0.0000 Buried
92 T L -1.7884 Soluble
93 G L -1.7010 Soluble
94 L L 0.0000 Buried
95 Q L -1.6327 Soluble
96 T L -0.8638 Soluble
97 G L -1.0922 Soluble
98 D L 0.0000 Buried
99 E L -1.6381 Soluble
100 A L 0.0000 Buried
101 N L -1.3367 Soluble
102 Y L 0.0000 Buried
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 A L 0.0000 Buried
106 T L 0.0000 Buried
107 W L -0.6459 Soluble
108 D L 0.0000 Buried
109 R L -2.9282 Soluble
110 R L -2.8574 Soluble
112 P L -1.5673 Soluble
113 T L -1.2515 Soluble
114 A L -1.3984 Soluble
115 Y L -0.6878 Soluble
116 V L 0.0000 Buried
117 V L 0.0000 Buried
118 F L 0.0000 Buried
119 G L 0.0000 Buried
120 G L -0.6006 Soluble
121 G L -1.1496 Soluble
122 T L 0.0000 Buried
123 K L -2.1557 Soluble
124 L L 0.0000 Buried
125 T L -0.4867 Soluble
126 V L -0.0135 Soluble
127 L L 1.3353 Aggregation-prone
128 E L -1.7368 Soluble
129 E L 0.0000 Buried
130 L L -0.7115 Soluble
131 Q L -1.8555 Soluble
132 A L -1.5705 Soluble
133 N L -2.1339 Soluble
134 K L -2.2389 Soluble
135 A L -0.6042 Soluble
136 T L 0.7314 Aggregation-prone
137 L L 2.0189 Aggregation-prone
138 V L 1.6268 Aggregation-prone
139 C L 1.1174 Aggregation-prone
140 L L 1.2687 Aggregation-prone
141 I L 0.6183 Aggregation-prone
142 S L -0.4659 Soluble
143 D L -1.7892 Soluble
144 F L 0.2549 Aggregation-prone
145 Y L 0.9097 Aggregation-prone
146 G L 0.3579 Aggregation-prone
147 V L 1.5059 Aggregation-prone
148 E L 0.3719 Aggregation-prone
149 T L 0.2757 Aggregation-prone
150 T L 0.0000 Buried
151 T L -0.4287 Soluble
152 P L -0.6091 Soluble
153 S L -1.2303 Soluble
154 K L -2.5741 Soluble
155 Q L -2.4208 Soluble
156 S L -1.7183 Soluble
157 N L -2.8013 Soluble
158 N L -2.7636 Soluble
159 K L -2.2048 Soluble
160 Y L -1.0866 Soluble
161 A L 0.0000 Buried
162 A L 0.0000 Buried
163 S L 0.0000 Buried
164 S L 0.0000 Buried
165 Y L 0.0000 Buried
166 L L 1.4940 Aggregation-prone
167 S L 0.2998 Aggregation-prone
168 C L 0.5231 Aggregation-prone
169 Q L -0.8340 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.2763 5.9355 CSV PDB
4.5 -0.304 5.9355 CSV PDB
5.0 -0.337 5.9355 CSV PDB
5.5 -0.3679 5.9355 CSV PDB
6.0 -0.387 5.9355 CSV PDB
6.5 -0.3858 5.9355 CSV PDB
7.0 -0.3636 5.9355 CSV PDB
7.5 -0.327 5.9355 CSV PDB
8.0 -0.2823 5.9355 CSV PDB
8.5 -0.2326 5.9354 CSV PDB
9.0 -0.1786 5.9351 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH