Fidasimtamab / 4x4x

A4DAB118_4x4x_A_B | Source PDB: 4x4x | Chains: A, B | Done
99.12
Yes
10 Å
Yes
Avg A4D Score
-0.5887
Max Score
1.6517
Min Score
-3.0133
Total Score
-131.87
Score CDR
-0.4712
Score non-CDR
-0.6199

Calculation Parameters

Chain Sequence(s) VQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDVWGQGTLVTVSDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSADFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEI input.pdb
Selected Chain(s) A (Heavy), B (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.0133
Maximum Score 1.6517
Average Score -0.5887
Total Score -131.8726

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V A 0.9382 Aggregation-prone
3 Q A -0.3377 Soluble
4 L A 0.0000 Buried
5 V A 0.2632 Aggregation-prone
6 E A 0.0000 Buried
7 S A -0.5238 Soluble
8 G A -0.8839 Soluble
9 G A 0.0342 Aggregation-prone
11 G A 0.6579 Aggregation-prone
12 L A 1.3458 Aggregation-prone
13 V A 0.0000 Buried
14 Q A -1.3374 Soluble
15 P A -1.4434 Soluble
16 G A -1.4074 Soluble
17 G A -1.0072 Soluble
18 S A -1.2490 Soluble
19 L A -1.0380 Soluble
20 R A -2.0420 Soluble
21 L A 0.0000 Buried
22 S A -0.4609 Soluble
23 C A 0.0000 Buried
24 A A -0.2936 Soluble
25 A A -0.3904 Soluble
26 S A -0.3700 Soluble
27 G A -0.0897 Soluble
28 F A -0.7017 Soluble
29 N A -1.9060 Soluble
30 I A 0.0000 Buried
35 K A -2.7110 Soluble
36 D A -2.9238 Soluble
37 T A 0.0000 Buried
38 Y A -0.6455 Soluble
39 I A 0.0000 Buried
40 H A 0.0000 Buried
41 W A 0.0000 Buried
42 V A 0.0000 Buried
43 R A 0.0000 Buried
44 Q A -0.5494 Soluble
45 A A -1.0844 Soluble
46 P A -1.2144 Soluble
47 G A -1.6053 Soluble
48 K A -2.4185 Soluble
49 G A -1.5948 Soluble
50 L A 0.0000 Buried
51 E A -1.0289 Soluble
52 W A 0.0000 Buried
53 V A 0.0000 Buried
54 A A 0.0000 Buried
55 R A -0.6019 Soluble
56 I A 0.0000 Buried
57 Y A -0.2997 Soluble
58 P A 0.0000 Buried
59 T A -1.2473 Soluble
62 N A -1.0590 Soluble
63 G A -0.3807 Soluble
64 Y A 0.5062 Aggregation-prone
65 T A -0.4555 Soluble
66 R A -2.0179 Soluble
67 Y A -1.9572 Soluble
68 A A -1.8944 Soluble
69 D A -2.7155 Soluble
70 S A -1.8458 Soluble
71 V A 0.0000 Buried
72 K A -2.9126 Soluble
74 G A -1.7930 Soluble
75 R A -1.5167 Soluble
76 F A 0.0000 Buried
77 T A -1.0937 Soluble
78 I A 0.0000 Buried
79 S A -0.1325 Soluble
80 A A -0.8928 Soluble
81 D A -1.4094 Soluble
82 T A -1.7129 Soluble
83 S A -1.5435 Soluble
84 K A -2.1709 Soluble
85 N A -1.7025 Soluble
86 T A 0.0000 Buried
87 A A 0.0000 Buried
88 Y A -0.4852 Soluble
89 L A 0.0000 Buried
90 Q A -1.0637 Soluble
91 M A 0.0000 Buried
92 N A -1.4351 Soluble
93 S A -1.2787 Soluble
94 L A 0.0000 Buried
95 R A -2.4276 Soluble
96 A A -1.7178 Soluble
97 E A -2.2650 Soluble
98 D A 0.0000 Buried
99 T A -0.3930 Soluble
100 A A 0.0000 Buried
101 V A 0.8222 Aggregation-prone
102 Y A 0.0000 Buried
103 Y A 0.0000 Buried
104 C A 0.0000 Buried
105 S A 0.0000 Buried
106 R A -0.6891 Soluble
107 W A -0.3500 Soluble
108 G A 0.0000 Buried
109 G A -0.7525 Soluble
110 D A -1.5653 Soluble
111 G A 0.0000 Buried
112 F A 1.6201 Aggregation-prone
113 Y A 1.0406 Aggregation-prone
114 A A 0.0000 Buried
115 M A 0.0000 Buried
116 D A 0.0007 Aggregation-prone
117 V A -0.0265 Soluble
118 W A -0.3061 Soluble
119 G A 0.0000 Buried
120 Q A -1.5214 Soluble
121 G A -0.4167 Soluble
122 T A 0.4171 Aggregation-prone
123 L A 1.6517 Aggregation-prone
124 V A 0.0000 Buried
125 T A 0.4204 Aggregation-prone
126 V A -0.4319 Soluble
127 S A -0.3301 Soluble
1 D B -2.2827 Soluble
2 I B 0.0000 Buried
3 Q B -2.3211 Soluble
4 M B 0.0000 Buried
5 T B -1.3754 Soluble
6 Q B 0.0000 Buried
7 S B -0.7685 Soluble
8 P B -0.6084 Soluble
9 S B -0.8323 Soluble
10 S B -0.8750 Soluble
11 L B -0.4548 Soluble
12 S B -0.3809 Soluble
13 A B -0.1128 Soluble
14 S B 0.1286 Aggregation-prone
15 V B 0.8969 Aggregation-prone
16 G B -0.6359 Soluble
17 D B -1.4657 Soluble
18 R B -2.2985 Soluble
19 V B 0.0000 Buried
20 T B -0.5925 Soluble
21 I B 0.0000 Buried
22 T B -0.8149 Soluble
23 C B 0.0000 Buried
24 R B -2.7136 Soluble
25 A B 0.0000 Buried
26 S B -2.2265 Soluble
27 Q B -3.0133 Soluble
28 D B -2.8909 Soluble
29 V B 0.0000 Buried
36 N B -1.7551 Soluble
37 T B -1.2069 Soluble
38 A B 0.1226 Aggregation-prone
39 V B 0.0000 Buried
40 A B 0.0000 Buried
41 W B 0.0000 Buried
42 Y B 0.0000 Buried
43 Q B 0.0000 Buried
44 Q B 0.0000 Buried
45 K B -1.7762 Soluble
46 P B -1.2057 Soluble
47 G B -1.7132 Soluble
48 K B -2.6353 Soluble
49 A B -1.6902 Soluble
50 P B 0.0000 Buried
51 K B -1.3984 Soluble
52 L B 0.0000 Buried
53 L B 0.0000 Buried
54 I B 0.0000 Buried
55 Y B 0.0000 Buried
56 S B 0.0000 Buried
57 A B 0.0000 Buried
65 D B -0.3638 Soluble
66 F B 1.1175 Aggregation-prone
67 L B 0.9648 Aggregation-prone
68 Y B 0.4740 Aggregation-prone
69 S B -0.0319 Soluble
70 G B -0.4511 Soluble
71 V B 0.0000 Buried
72 P B -0.3564 Soluble
74 S B -0.4167 Soluble
75 R B -0.8646 Soluble
76 F B 0.0000 Buried
77 S B -0.2299 Soluble
78 G B -0.4196 Soluble
79 S B -1.1038 Soluble
80 R B -1.8835 Soluble
83 S B -1.2658 Soluble
84 G B -1.8792 Soluble
85 T B -2.1710 Soluble
86 D B -1.7609 Soluble
87 F B 0.0000 Buried
88 T B -0.9457 Soluble
89 L B 0.0000 Buried
90 T B -0.6322 Soluble
91 I B 0.0000 Buried
92 S B -1.5168 Soluble
93 S B -1.1301 Soluble
94 L B 0.0000 Buried
95 Q B -0.5711 Soluble
96 P B -0.6988 Soluble
97 E B -1.6344 Soluble
98 D B 0.0000 Buried
99 F B -0.3576 Soluble
100 A B 0.0000 Buried
101 T B 0.0000 Buried
102 Y B 0.0000 Buried
103 Y B 0.0000 Buried
104 C B 0.0000 Buried
105 Q B 0.0000 Buried
106 Q B 0.0000 Buried
107 H B 0.0000 Buried
108 Y B 1.0064 Aggregation-prone
109 T B 0.1344 Aggregation-prone
114 T B -0.3851 Soluble
115 P B -0.5517 Soluble
116 P B 0.0000 Buried
117 T B -0.6081 Soluble
118 F B -0.4525 Soluble
119 G B 0.0000 Buried
120 Q B -1.9341 Soluble
121 G B 0.0000 Buried
122 T B 0.0000 Buried
123 K B -1.3148 Soluble
124 V B 0.0000 Buried
125 E B -0.8737 Soluble
126 I B 0.4827 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.5694 4.6607 CSV PDB
4.5 -0.6098 4.543 CSV PDB
5.0 -0.6555 4.4124 CSV PDB
5.5 -0.6999 4.277 CSV PDB
6.0 -0.7357 4.1401 CSV PDB
6.5 -0.7578 4.0029 CSV PDB
7.0 -0.7664 3.8665 CSV PDB
7.5 -0.7659 3.7328 CSV PDB
8.0 -0.759 3.6068 CSV PDB
8.5 -0.7453 3.4993 CSV PDB
9.0 -0.7236 3.424 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH