Diridavumab / 8dim

A4DAB087_8dim_B_C | Source PDB: 8dim | Chains: B, C | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.4797
Max Score
3.0205
Min Score
-3.0948
Total Score
-108.9
Score CDR
-0.231
Score non-CDR
-0.5555

Calculation Parameters

Chain Sequence(s) VQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRRPTAYVVFGGGTKLTVL input.pdb
Selected Chain(s) B (Heavy), C (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.0948
Maximum Score 3.0205
Average Score -0.4797
Total Score -108.9024

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V B 1.0254 Aggregation-prone
3 Q B -0.6340 Soluble
4 L B 0.0000 Buried
5 V B -0.6812 Soluble
6 E B -0.6851 Soluble
7 S B -0.7818 Soluble
8 G B -0.6395 Soluble
9 A B -0.0622 Soluble
11 E B 0.0405 Aggregation-prone
12 V B 1.1491 Aggregation-prone
13 K B -0.6869 Soluble
14 K B -1.8904 Soluble
15 P B -2.0338 Soluble
16 G B -1.5639 Soluble
17 S B -1.2448 Soluble
18 S B -1.3685 Soluble
19 V B 0.0000 Buried
20 K B -1.9664 Soluble
21 V B 0.0000 Buried
22 S B -0.6363 Soluble
23 C B 0.0000 Buried
24 K B -1.2370 Soluble
25 A B -0.4924 Soluble
26 S B -0.5812 Soluble
27 G B -0.4629 Soluble
28 G B 0.0193 Aggregation-prone
29 P B 0.3985 Aggregation-prone
30 F B 1.7322 Aggregation-prone
35 R B 0.6617 Aggregation-prone
36 S B 0.8308 Aggregation-prone
37 Y B 0.9221 Aggregation-prone
38 A B 0.0000 Buried
39 I B 0.0000 Buried
40 S B 0.0000 Buried
41 W B 0.0000 Buried
42 V B 0.0000 Buried
43 R B -0.5008 Soluble
44 Q B -0.7546 Soluble
45 A B -1.0721 Soluble
46 P B -0.8744 Soluble
47 G B -1.2384 Soluble
48 Q B -1.7842 Soluble
49 G B -1.2157 Soluble
50 P B 0.0000 Buried
51 E B -0.7857 Soluble
52 W B 0.0000 Buried
53 M B 0.0000 Buried
54 G B 0.0000 Buried
55 G B 0.0000 Buried
56 I B 0.0000 Buried
57 I B 0.0000 Buried
58 P B 0.0000 Buried
59 I B 3.0205 Aggregation-prone
62 F B 2.8625 Aggregation-prone
63 G B 1.1213 Aggregation-prone
64 T B 0.4011 Aggregation-prone
65 T B -0.1613 Soluble
66 K B -0.7122 Soluble
67 Y B -0.7450 Soluble
68 A B 0.0000 Buried
69 P B -1.5908 Soluble
70 K B -2.2694 Soluble
71 F B 0.0000 Buried
72 Q B -2.1077 Soluble
74 G B -1.4454 Soluble
75 R B -1.1702 Soluble
76 V B 0.0000 Buried
77 T B -0.7139 Soluble
78 I B 0.0000 Buried
79 T B -0.2861 Soluble
80 A B -0.3091 Soluble
81 D B -0.3677 Soluble
82 D B -0.0192 Soluble
83 F B 1.4408 Aggregation-prone
84 A B 0.3886 Aggregation-prone
85 G B -0.1432 Soluble
86 T B 0.0000 Buried
87 V B 0.0000 Buried
88 Y B -0.3495 Soluble
89 M B 0.0000 Buried
90 E B -1.2941 Soluble
91 L B 0.0000 Buried
92 S B -1.0136 Soluble
93 S B -0.9571 Soluble
94 L B 0.0000 Buried
95 R B -2.5505 Soluble
96 S B -1.8960 Soluble
97 E B -2.2437 Soluble
98 D B 0.0000 Buried
99 T B -0.5666 Soluble
100 A B 0.0000 Buried
101 M B -0.1003 Soluble
102 Y B 0.0000 Buried
103 Y B 0.0000 Buried
104 C B 0.0000 Buried
105 A B 0.0000 Buried
106 K B 0.1411 Aggregation-prone
107 H B 0.0000 Buried
108 M B 0.5415 Aggregation-prone
109 G B 0.5065 Aggregation-prone
110 Y B 1.3934 Aggregation-prone
111 Q B -0.1471 Soluble
112A V B 0.0000 Buried
112 R B -0.2693 Soluble
113 E B 0.0000 Buried
114 T B 0.0000 Buried
115 M B 0.0000 Buried
116 D B -0.7169 Soluble
117 V B -0.0300 Soluble
118 W B -0.4466 Soluble
119 G B 0.0000 Buried
120 K B -1.7742 Soluble
121 G B -0.8729 Soluble
122 T B 0.0000 Buried
123 T B 0.0730 Aggregation-prone
124 V B 0.0000 Buried
125 T B 0.1321 Aggregation-prone
126 V B -0.2269 Soluble
3 V C 1.5810 Aggregation-prone
4 L C 0.0000 Buried
5 T C 0.0275 Aggregation-prone
6 Q C 0.0000 Buried
7 P C -0.5217 Soluble
8 P C -0.7528 Soluble
9 S C -0.8020 Soluble
11 V C -0.2469 Soluble
12 S C -0.0641 Soluble
13 A C -0.1516 Soluble
14 A C -0.2752 Soluble
15 P C -0.9664 Soluble
16 G C -1.7346 Soluble
17 Q C -2.2628 Soluble
18 K C -2.4232 Soluble
19 V C 0.0000 Buried
20 T C -0.4764 Soluble
21 I C 0.0000 Buried
22 S C -0.3147 Soluble
23 C C 0.0000 Buried
24 S C -0.2107 Soluble
25 G C -0.0277 Soluble
26 S C -0.3780 Soluble
27 S C -0.9114 Soluble
28 S C -1.3205 Soluble
29 N C 0.0000 Buried
30 I C 0.0000 Buried
35 G C -1.2184 Soluble
36 N C -1.7338 Soluble
37 D C -0.9479 Soluble
38 Y C 0.0045 Aggregation-prone
39 V C 0.0000 Buried
40 S C 0.0000 Buried
41 W C 0.0000 Buried
42 Y C 0.0000 Buried
43 Q C 0.0000 Buried
44 Q C 0.0000 Buried
45 L C -0.2920 Soluble
46 P C -0.4376 Soluble
47 G C -0.7022 Soluble
48 T C -0.7043 Soluble
49 A C -0.6680 Soluble
50 P C 0.0000 Buried
51 K C -1.1051 Soluble
52 L C 0.0000 Buried
53 L C 0.0000 Buried
54 I C 0.0000 Buried
55 Y C -1.1459 Soluble
56 D C -1.4259 Soluble
57 N C -1.4638 Soluble
65 N C -2.3428 Soluble
66 K C -2.5928 Soluble
67 R C -2.2940 Soluble
68 P C -1.0317 Soluble
69 S C -0.7524 Soluble
70 G C -0.8465 Soluble
71 I C -0.9467 Soluble
72 P C -1.3155 Soluble
74 D C -2.2141 Soluble
75 R C -1.5728 Soluble
76 F C 0.0000 Buried
77 S C -1.3800 Soluble
78 G C -1.2593 Soluble
79 S C -1.2421 Soluble
80 K C -1.0964 Soluble
83 S C -0.8186 Soluble
84 G C -1.0269 Soluble
85 T C -0.9301 Soluble
86 S C -0.6696 Soluble
87 A C 0.0000 Buried
88 T C -0.5549 Soluble
89 L C 0.0000 Buried
90 G C -0.6406 Soluble
91 I C 0.0000 Buried
92 T C -1.8234 Soluble
93 G C -1.5794 Soluble
94 L C 0.0000 Buried
95 Q C -1.6446 Soluble
96 T C -0.8831 Soluble
97 G C -1.0912 Soluble
98 D C 0.0000 Buried
99 E C -1.3530 Soluble
100 A C 0.0000 Buried
101 N C -0.9719 Soluble
102 Y C 0.0000 Buried
103 Y C 0.0000 Buried
104 C C 0.0000 Buried
105 A C 0.0000 Buried
106 T C 0.0000 Buried
107 W C -0.7991 Soluble
108 D C -1.4909 Soluble
109 R C -3.0948 Soluble
110 R C -2.9283 Soluble
112 P C -1.6641 Soluble
113 T C -1.3524 Soluble
114 A C -1.5934 Soluble
115 Y C -0.7245 Soluble
116 V C 0.0000 Buried
117 V C 0.0000 Buried
118 F C 0.2683 Aggregation-prone
119 G C 0.0412 Aggregation-prone
120 G C -0.4879 Soluble
121 G C -1.0042 Soluble
122 T C 0.0000 Buried
123 K C -1.6514 Soluble
124 L C 0.0000 Buried
125 T C -0.2945 Soluble
126 V C 0.0631 Aggregation-prone
127 L C 1.3262 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.3595 5.7937 CSV PDB
4.5 -0.3808 5.7937 CSV PDB
5.0 -0.4061 5.7937 CSV PDB
5.5 -0.4294 5.7937 CSV PDB
6.0 -0.4429 5.7937 CSV PDB
6.5 -0.44 5.7937 CSV PDB
7.0 -0.4202 5.7937 CSV PDB
7.5 -0.3898 5.7936 CSV PDB
8.0 -0.354 5.7936 CSV PDB
8.5 -0.315 5.7935 CSV PDB
9.0 -0.2727 5.7931 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH