Invikafusp / 8tfn

A4DAB143_8tfn_H_L | Source PDB: 8tfn | Chains: H, L | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.7461
Max Score
1.9699
Min Score
-3.725
Total Score
-295.47
Score CDR
-0.485
Score non-CDR
-0.7804

Calculation Parameters

Chain Sequence(s) QVQLVQSGAEVKKPGSSVKVSCKASGHDFRLTYIHWVRQAPGQGLEWMGRVSAGSGNVKYNEKFKGRVTITADTSTSTAYMELSSLRSEDTAVYYCAVSYYSYDVLDYWGQGTTVTVSTKGPSVFPLAGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTQTYICNVNHKPSNTKVDKKDIQMTQSPSFLSASVGDRVTITCKASQNVADRVVWHQQKPGKAPKALIYSSSHRYKGVPSRFSGSGSGTEFTLTISSLQPEDFATYFCQQFKSYPLTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSASVVCLLNNFYPRKVQWKVNALQSGNSQESQDSKDSTYSLSSTLTADYEKHKVYACEVTHQGLSSPVTFNRG input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.725
Maximum Score 1.9699
Average Score -0.7461
Total Score -295.4652

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q H -1.4155 Soluble
2 V H -0.8953 Soluble
3 Q H -1.3478 Soluble
4 L H 0.0000 Buried
5 V H 0.4491 Aggregation-prone
6 Q H 0.0000 Buried
7 S H -0.5792 Soluble
8 G H -0.6119 Soluble
9 A H -0.3592 Soluble
11 E H -0.8330 Soluble
12 V H -0.3514 Soluble
13 K H -1.3524 Soluble
14 K H -2.2612 Soluble
15 P H -2.1493 Soluble
16 G H -1.6557 Soluble
17 S H -1.1882 Soluble
18 S H -1.3493 Soluble
19 V H 0.0000 Buried
20 K H -2.1758 Soluble
21 V H 0.0000 Buried
22 S H -0.6046 Soluble
23 C H 0.0000 Buried
24 K H -1.0766 Soluble
25 A H -0.8555 Soluble
26 S H -1.1228 Soluble
27 G H -1.2531 Soluble
28 H H -1.0648 Soluble
29 D H -1.1737 Soluble
30 F H 0.0000 Buried
35 R H -1.7080 Soluble
36 L H 0.5401 Aggregation-prone
37 T H 0.0000 Buried
38 Y H 0.5834 Aggregation-prone
39 I H 0.0000 Buried
40 H H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H 0.0000 Buried
44 Q H -0.8202 Soluble
45 A H -1.0340 Soluble
46 P H -0.8801 Soluble
47 G H -1.3644 Soluble
48 Q H -1.8880 Soluble
49 G H -1.3780 Soluble
50 L H -0.7135 Soluble
51 E H -0.6768 Soluble
52 W H 0.0000 Buried
53 M H 0.0000 Buried
54 G H 0.0000 Buried
55 R H 0.0000 Buried
56 V H 0.0000 Buried
57 S H 0.0000 Buried
58 A H 0.0000 Buried
59 G H -1.3741 Soluble
62 S H -0.9360 Soluble
63 G H -1.1742 Soluble
64 N H -0.9350 Soluble
65 V H -0.1420 Soluble
66 K H -0.6500 Soluble
67 Y H -0.8591 Soluble
68 N H -1.9010 Soluble
69 E H -3.3312 Soluble
70 K H -3.1884 Soluble
71 F H 0.0000 Buried
72 K H -3.1097 Soluble
74 G H -1.8674 Soluble
75 R H -1.8543 Soluble
76 V H 0.0000 Buried
77 T H -0.7991 Soluble
78 I H 0.0000 Buried
79 T H -0.3461 Soluble
80 A H -0.7924 Soluble
81 D H -1.2109 Soluble
82 T H -1.2146 Soluble
83 S H -0.6960 Soluble
84 T H -0.5922 Soluble
85 S H -1.1048 Soluble
86 T H 0.0000 Buried
87 A H 0.0000 Buried
88 Y H -0.7020 Soluble
89 M H 0.0000 Buried
90 E H -1.5680 Soluble
91 L H 0.0000 Buried
92 S H -1.1807 Soluble
93 S H -1.1758 Soluble
94 L H 0.0000 Buried
95 R H -2.9106 Soluble
96 S H -2.3879 Soluble
97 E H -2.4472 Soluble
98 D H 0.0000 Buried
99 T H -0.7538 Soluble
100 A H 0.0000 Buried
101 V H 0.2449 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 V H 0.0000 Buried
107 S H 0.0000 Buried
108 Y H 1.3567 Aggregation-prone
109 Y H 1.9699 Aggregation-prone
110 S H 1.2582 Aggregation-prone
112 Y H 1.4406 Aggregation-prone
113 D H 0.0000 Buried
114 V H 0.0000 Buried
115 L H 0.0000 Buried
116 D H 0.0000 Buried
117 Y H -0.2750 Soluble
118 W H 0.0000 Buried
119 G H 0.0000 Buried
120 Q H -1.2291 Soluble
121 G H -0.5067 Soluble
122 T H 0.0000 Buried
123 T H -0.0625 Soluble
124 V H 0.0000 Buried
125 T H -0.5840 Soluble
126 V H -1.3370 Soluble
127 S H -0.9494 Soluble
128 T H -1.1067 Soluble
129 K H -1.8463 Soluble
130 G H -1.6515 Soluble
131 P H -1.0099 Soluble
132 S H -0.5800 Soluble
133 V H 0.0000 Buried
134 F H -0.7944 Soluble
135 P H -0.7972 Soluble
136 L H 0.0000 Buried
137 A H 0.0230 Aggregation-prone
138 G H -0.4837 Soluble
139 T H -0.1962 Soluble
140 A H 0.0723 Aggregation-prone
141 A H 0.0000 Buried
142 L H 0.4564 Aggregation-prone
143 G H 0.0000 Buried
144 C H 0.0000 Buried
145 L H 0.0000 Buried
146 V H -0.2529 Soluble
147 K H -0.9801 Soluble
148 D H -0.8292 Soluble
149 Y H 0.0000 Buried
150 F H -0.8472 Soluble
151 P H -1.0391 Soluble
152 E H -1.4074 Soluble
153 P H -1.2210 Soluble
154 V H -0.7281 Soluble
155 T H -0.5382 Soluble
156 V H -0.3578 Soluble
157 S H -0.4211 Soluble
158 W H 0.0000 Buried
159 N H -0.8130 Soluble
160 S H -0.7857 Soluble
161 G H -0.5440 Soluble
162 A H -0.1142 Soluble
163 L H 0.3402 Aggregation-prone
164 T H -0.1023 Soluble
165 S H -0.3993 Soluble
166 G H -0.2863 Soluble
167 V H 0.2476 Aggregation-prone
168 H H -0.1635 Soluble
169 T H -0.0210 Soluble
170 F H 0.0000 Buried
171 P H -0.1634 Soluble
172 A H 0.1766 Aggregation-prone
173 V H 0.5397 Aggregation-prone
174 L H 1.2693 Aggregation-prone
175 Q H 0.2015 Aggregation-prone
176 S H -0.1638 Soluble
177 S H -0.2238 Soluble
178 G H 0.0985 Aggregation-prone
179 L H -0.1064 Soluble
180 Y H 0.3783 Aggregation-prone
181 S H 0.0000 Buried
182 L H 0.1314 Aggregation-prone
183 S H 0.0000 Buried
184 S H 0.0000 Buried
185 V H 0.0000 Buried
186 V H 0.0000 Buried
187 T H 0.0648 Aggregation-prone
188 Q H -1.0160 Soluble
189 T H -0.5482 Soluble
190 Y H 0.0235 Aggregation-prone
191 I H -0.8456 Soluble
192 C H 0.0000 Buried
193 N H -1.6596 Soluble
194 V H 0.0000 Buried
195 N H -1.7771 Soluble
196 H H 0.0000 Buried
197 K H -2.6853 Soluble
198 P H -1.8216 Soluble
199 S H -2.0434 Soluble
200 N H -2.2513 Soluble
201 T H -2.0553 Soluble
202 K H -2.6755 Soluble
203 V H -1.8716 Soluble
204 D H -2.7196 Soluble
205 K H -2.0950 Soluble
206 K H -1.9948 Soluble
1 D L -2.3998 Soluble
2 I L 0.0000 Buried
3 Q L -2.1411 Soluble
4 M L 0.0000 Buried
5 T L -1.1821 Soluble
6 Q L 0.0000 Buried
7 S L -0.3173 Soluble
8 P L 0.2397 Aggregation-prone
9 S L 0.4126 Aggregation-prone
10 F L 1.4489 Aggregation-prone
11 L L 0.6301 Aggregation-prone
12 S L -0.3602 Soluble
13 A L 0.0000 Buried
14 S L -1.1891 Soluble
15 V L -0.4493 Soluble
16 G L -1.5845 Soluble
17 D L -2.7662 Soluble
18 R L -2.7647 Soluble
19 V L -1.2562 Soluble
20 T L -0.6444 Soluble
21 I L 0.0000 Buried
22 T L -0.9112 Soluble
23 C L 0.0000 Buried
24 K L -2.6235 Soluble
25 A L 0.0000 Buried
26 S L -2.2743 Soluble
27 Q L -2.7668 Soluble
28 N L -2.6002 Soluble
29 V L 0.0000 Buried
36 A L -1.9505 Soluble
37 D L -2.4463 Soluble
38 R L -1.9058 Soluble
39 V L 0.0000 Buried
40 V L 0.0000 Buried
41 W L 0.0000 Buried
42 H L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L -1.3375 Soluble
45 K L -1.6678 Soluble
46 P L -1.1926 Soluble
47 G L -1.6248 Soluble
48 K L -2.5153 Soluble
49 A L -1.7588 Soluble
50 P L 0.0000 Buried
51 K L -1.9608 Soluble
52 A L 0.0000 Buried
53 L L 0.0000 Buried
54 I L 0.0000 Buried
55 Y L -0.4628 Soluble
56 S L -1.1190 Soluble
57 S L 0.0000 Buried
65 S L -1.2250 Soluble
66 H L -1.5261 Soluble
67 R L -1.5709 Soluble
68 Y L -1.1328 Soluble
69 K L -2.0818 Soluble
70 G L -1.3217 Soluble
71 V L -0.9522 Soluble
72 P L -0.6989 Soluble
74 S L -0.6316 Soluble
75 R L -0.9646 Soluble
76 F L 0.0000 Buried
77 S L -0.6525 Soluble
78 G L -0.6108 Soluble
79 S L -0.9941 Soluble
80 G L -1.4326 Soluble
83 S L -1.6937 Soluble
84 G L -2.0240 Soluble
85 T L -2.3736 Soluble
86 E L -2.8608 Soluble
87 F L 0.0000 Buried
88 T L -0.8446 Soluble
89 L L 0.0000 Buried
90 T L -0.7591 Soluble
91 I L 0.0000 Buried
92 S L -1.7214 Soluble
93 S L -1.7297 Soluble
94 L L 0.0000 Buried
95 Q L -1.3603 Soluble
96 P L -1.1861 Soluble
97 E L -2.0716 Soluble
98 D L 0.0000 Buried
99 F L -0.7272 Soluble
100 A L 0.0000 Buried
101 T L -0.5183 Soluble
102 Y L 0.0000 Buried
103 F L 0.0000 Buried
104 C L 0.0000 Buried
105 Q L 0.0000 Buried
106 Q L 0.0000 Buried
107 F L 0.0000 Buried
108 K L -2.0726 Soluble
109 S L -0.9763 Soluble
114 Y L -0.6503 Soluble
115 P L -0.8669 Soluble
116 L L 0.0000 Buried
117 T L -0.8432 Soluble
118 F L 0.0000 Buried
119 G L 0.0000 Buried
120 Q L -1.3372 Soluble
121 G L 0.0000 Buried
122 T L 0.0000 Buried
123 K L -0.5087 Soluble
124 L L 0.0000 Buried
125 E L -0.7629 Soluble
126 I L -1.1159 Soluble
127 K L -1.7687 Soluble
128 R L -1.3639 Soluble
129 T L 0.0776 Aggregation-prone
130 V L 1.0903 Aggregation-prone
131 A L 0.1113 Aggregation-prone
132 A L 0.1611 Aggregation-prone
133 P L 0.1798 Aggregation-prone
134 S L 0.2331 Aggregation-prone
135 V L 0.6547 Aggregation-prone
136 F L 0.7082 Aggregation-prone
137 I L 0.7935 Aggregation-prone
138 F L 0.0000 Buried
139 P L -0.4279 Soluble
140 P L -0.4486 Soluble
141 S L -1.5028 Soluble
142 D L -2.8470 Soluble
143 E L -3.0333 Soluble
144 Q L 0.0000 Buried
145 L L -1.3518 Soluble
146 K L -2.5423 Soluble
147 S L -1.3727 Soluble
148 A L -0.8333 Soluble
149 S L 0.1088 Aggregation-prone
150 V L 0.0000 Buried
151 V L 0.0000 Buried
152 C L 0.0000 Buried
153 L L 0.0000 Buried
154 L L 0.0000 Buried
155 N L 0.0000 Buried
156 N L -1.1267 Soluble
157 F L 0.0000 Buried
158 Y L 0.0000 Buried
159 P L -1.2667 Soluble
160 R L -2.2279 Soluble
161 K L -1.9949 Soluble
162 V L -1.1776 Soluble
163 Q L -1.1956 Soluble
164 W L 0.0000 Buried
165 K L -0.9935 Soluble
166 V L -1.2825 Soluble
167 N L -1.3549 Soluble
168 A L -0.5995 Soluble
169 L L -0.1789 Soluble
170 Q L -1.1002 Soluble
171 S L -0.8874 Soluble
172 G L -0.8594 Soluble
173 N L -0.8955 Soluble
174 S L -1.2358 Soluble
175 Q L -1.2503 Soluble
176 E L -1.9052 Soluble
177 S L -0.9486 Soluble
178 Q L -2.3716 Soluble
179 D L -1.9253 Soluble
180 S L -1.9205 Soluble
181 K L -3.0277 Soluble
182 D L -3.0142 Soluble
183 S L -2.3682 Soluble
184 T L 0.0000 Buried
185 Y L -1.1912 Soluble
186 S L -0.5517 Soluble
187 L L -0.4547 Soluble
188 S L 0.0000 Buried
189 S L 0.0000 Buried
190 T L -0.6128 Soluble
191 L L 0.0000 Buried
192 T L -0.3830 Soluble
193 A L -1.4842 Soluble
194 D L -2.8744 Soluble
195 Y L -2.4050 Soluble
196 E L -3.7250 Soluble
197 K L -3.5760 Soluble
198 H L -3.2564 Soluble
199 K L -2.9640 Soluble
200 V L -0.9967 Soluble
201 Y L 0.0000 Buried
202 A L -0.2813 Soluble
203 C L 0.0000 Buried
204 E L -0.4911 Soluble
205 V L 0.0000 Buried
206 T L -0.9613 Soluble
207 H L -1.1142 Soluble
208 Q L -1.1314 Soluble
209 G L -0.3435 Soluble
210 L L -0.1277 Soluble
211 S L -0.6654 Soluble
212 S L -0.3520 Soluble
213 P L -0.0757 Soluble
214 V L 0.7438 Aggregation-prone
215 T L 0.2824 Aggregation-prone
216 F L -0.0823 Soluble
217 N L -1.6049 Soluble
218 R L -2.9250 Soluble
219 G L -1.6803 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.8061 3.3258 CSV PDB
4.5 -0.8485 3.3193 CSV PDB
5.0 -0.8971 3.3119 CSV PDB
5.5 -0.9392 3.3106 CSV PDB
6.0 -0.9613 3.3268 CSV PDB
6.5 -0.9543 3.3698 CSV PDB
7.0 -0.9207 3.4366 CSV PDB
7.5 -0.8708 3.5172 CSV PDB
8.0 -0.8129 3.6035 CSV PDB
8.5 -0.7493 3.6918 CSV PDB
9.0 -0.6799 3.7799 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH