Diridavumab / 8diu

A4DAB087_8diu_H_I | Source PDB: 8diu | Chains: H, I | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.4947
Max Score
2.9868
Min Score
-3.0711
Total Score
-112.79
Score CDR
-0.2492
Score non-CDR
-0.5691

Calculation Parameters

Chain Sequence(s) VQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRRPTAYVVFGGGTKLTVL input.pdb
Selected Chain(s) H (Heavy), I (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.0711
Maximum Score 2.9868
Average Score -0.4947
Total Score -112.7947

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V H 1.1186 Aggregation-prone
3 Q H -0.3080 Soluble
4 L H 0.0000 Buried
5 V H 0.5423 Aggregation-prone
6 E H -0.1515 Soluble
7 S H -0.5140 Soluble
8 G H -0.5210 Soluble
9 A H -0.1268 Soluble
11 E H -0.1561 Soluble
12 V H 0.8399 Aggregation-prone
13 K H -0.7967 Soluble
14 K H -2.1388 Soluble
15 P H -2.0727 Soluble
16 G H -1.6743 Soluble
17 S H -1.2745 Soluble
18 S H -1.4231 Soluble
19 V H 0.0000 Buried
20 K H -2.1233 Soluble
21 V H 0.0000 Buried
22 S H -0.5641 Soluble
23 C H 0.0000 Buried
24 K H -0.8271 Soluble
25 A H -0.1943 Soluble
26 S H -0.3080 Soluble
27 G H -0.4237 Soluble
28 G H -0.1819 Soluble
29 P H 0.2228 Aggregation-prone
30 F H 1.5699 Aggregation-prone
35 R H 0.5944 Aggregation-prone
36 S H 0.7046 Aggregation-prone
37 Y H 0.8291 Aggregation-prone
38 A H 0.0000 Buried
39 I H 0.0000 Buried
40 S H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H 0.0000 Buried
44 Q H 0.0000 Buried
45 A H -0.7904 Soluble
46 P H -0.8055 Soluble
47 G H -1.1831 Soluble
48 Q H -1.6507 Soluble
49 G H -1.0231 Soluble
50 P H 0.0000 Buried
51 E H -0.5059 Soluble
52 W H 0.0000 Buried
53 M H 0.0000 Buried
54 G H 0.0000 Buried
55 G H 0.0000 Buried
56 I H 0.0000 Buried
57 I H 0.0000 Buried
58 P H 0.0000 Buried
59 I H 2.9868 Aggregation-prone
62 F H 2.8034 Aggregation-prone
63 G H 1.1106 Aggregation-prone
64 T H 0.4304 Aggregation-prone
65 T H -0.2290 Soluble
66 K H -0.7550 Soluble
67 Y H -0.8039 Soluble
68 A H 0.0000 Buried
69 P H -1.5638 Soluble
70 K H -2.2755 Soluble
71 F H 0.0000 Buried
72 Q H -2.1869 Soluble
74 G H -1.5247 Soluble
75 R H -1.3897 Soluble
76 V H 0.0000 Buried
77 T H -0.9026 Soluble
78 I H 0.0000 Buried
79 T H -0.6634 Soluble
80 A H -0.9993 Soluble
81 D H -1.6296 Soluble
82 D H -0.6279 Soluble
83 F H 1.1097 Aggregation-prone
84 A H 0.0549 Aggregation-prone
85 G H -0.5578 Soluble
86 T H 0.0000 Buried
87 V H 0.0000 Buried
88 Y H -0.7689 Soluble
89 M H 0.0000 Buried
90 E H -1.6371 Soluble
91 L H 0.0000 Buried
92 S H -1.2115 Soluble
93 S H -1.0964 Soluble
94 L H 0.0000 Buried
95 R H -2.8886 Soluble
96 S H -2.2249 Soluble
97 E H -2.0553 Soluble
98 D H 0.0000 Buried
99 T H -0.6715 Soluble
100 A H 0.0000 Buried
101 M H 0.0528 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 K H 0.1740 Aggregation-prone
107 H H 0.0000 Buried
108 M H 0.4668 Aggregation-prone
109 G H 0.3877 Aggregation-prone
110 Y H 1.1787 Aggregation-prone
111 Q H -0.2971 Soluble
112A V H 0.0000 Buried
112 R H -0.5281 Soluble
113 E H 0.0000 Buried
114 T H 0.0000 Buried
115 M H 0.0000 Buried
116 D H -0.5602 Soluble
117 V H 0.0567 Aggregation-prone
118 W H -0.2897 Soluble
119 G H -0.6962 Soluble
120 K H -1.5322 Soluble
121 G H 0.0000 Buried
122 T H 0.0000 Buried
123 T H 0.1108 Aggregation-prone
124 V H 0.0000 Buried
125 T H -0.1263 Soluble
126 V H 0.0000 Buried
127 S H -0.9974 Soluble
3 V I 1.5533 Aggregation-prone
4 L I 0.0000 Buried
5 T I 0.0235 Aggregation-prone
6 Q I 0.0000 Buried
7 P I -0.5375 Soluble
8 P I -0.8055 Soluble
9 S I -0.8329 Soluble
11 V I -0.2746 Soluble
12 S I -0.0616 Soluble
13 A I -0.0701 Soluble
14 A I -0.2113 Soluble
15 P I -0.9165 Soluble
16 G I -1.6555 Soluble
17 Q I -2.1160 Soluble
18 K I -2.2630 Soluble
19 V I -0.8993 Soluble
20 T I -0.3327 Soluble
21 I I 0.0000 Buried
22 S I -0.2905 Soluble
23 C I 0.0000 Buried
24 S I -0.2392 Soluble
25 G I -0.0158 Soluble
26 S I -0.4121 Soluble
27 S I -0.9445 Soluble
28 S I -1.3478 Soluble
29 N I 0.0000 Buried
30 I I 0.0000 Buried
35 G I -1.2011 Soluble
36 N I -1.7465 Soluble
37 D I -0.9813 Soluble
38 Y I -0.0628 Soluble
39 V I 0.0000 Buried
40 S I 0.0000 Buried
41 W I 0.0000 Buried
42 Y I 0.0000 Buried
43 Q I 0.0000 Buried
44 Q I -0.8222 Soluble
45 L I -0.5037 Soluble
46 P I -0.5274 Soluble
47 G I -0.7673 Soluble
48 T I -0.8120 Soluble
49 A I -0.8001 Soluble
50 P I 0.0000 Buried
51 K I -1.2450 Soluble
52 L I 0.0000 Buried
53 L I 0.0000 Buried
54 I I 0.0000 Buried
55 Y I -1.1852 Soluble
56 D I -1.5396 Soluble
57 N I -1.5432 Soluble
65 N I -2.4737 Soluble
66 K I -2.6238 Soluble
67 R I -2.0295 Soluble
68 P I -0.8779 Soluble
69 S I -0.5310 Soluble
70 G I -0.7586 Soluble
71 I I -0.9521 Soluble
72 P I -1.2217 Soluble
74 D I -2.1469 Soluble
75 R I -1.5597 Soluble
76 F I 0.0000 Buried
77 S I -1.3683 Soluble
78 G I -1.3166 Soluble
79 S I -1.3441 Soluble
80 K I -1.0449 Soluble
83 S I -0.7731 Soluble
84 G I -0.9951 Soluble
85 T I -0.9105 Soluble
86 S I -0.6526 Soluble
87 A I 0.0000 Buried
88 T I -0.5438 Soluble
89 L I 0.0000 Buried
90 G I 0.0000 Buried
91 I I 0.0000 Buried
92 T I -1.8237 Soluble
93 G I -1.7647 Soluble
94 L I 0.0000 Buried
95 Q I -1.6315 Soluble
96 T I -0.8944 Soluble
97 G I -1.1040 Soluble
98 D I 0.0000 Buried
99 E I -1.4177 Soluble
100 A I 0.0000 Buried
101 N I -1.0316 Soluble
102 Y I 0.0000 Buried
103 Y I 0.0000 Buried
104 C I 0.0000 Buried
105 A I 0.0000 Buried
106 T I 0.0000 Buried
107 W I 0.0000 Buried
108 D I -1.5135 Soluble
109 R I -3.0711 Soluble
110 R I -2.9062 Soluble
112 P I -1.6324 Soluble
113 T I -1.2911 Soluble
114 A I -1.5837 Soluble
115 Y I -0.6647 Soluble
116 V I 0.0000 Buried
117 V I 0.0000 Buried
118 F I 0.0000 Buried
119 G I 0.0000 Buried
120 G I -0.4764 Soluble
121 G I -0.9638 Soluble
122 T I 0.0000 Buried
123 K I -1.7729 Soluble
124 L I 0.0000 Buried
125 T I -0.2914 Soluble
126 V I 0.2623 Aggregation-prone
127 L I 1.3729 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.3883 5.8746 CSV PDB
4.5 -0.4153 5.7723 CSV PDB
5.0 -0.445 5.7723 CSV PDB
5.5 -0.4709 5.7723 CSV PDB
6.0 -0.485 5.7723 CSV PDB
6.5 -0.4815 5.7723 CSV PDB
7.0 -0.4615 5.7723 CSV PDB
7.5 -0.4316 5.7723 CSV PDB
8.0 -0.3963 5.7722 CSV PDB
8.5 -0.3567 5.7721 CSV PDB
9.0 -0.3122 5.7718 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH