Cinrebafusp / 6dn0

A4DAB066_6dn0_C_D | Source PDB: 6dn0 | Chains: C, D | Done
98.67
Yes
10 Å
Yes
Avg A4D Score
-0.5897
Max Score
2.1211
Min Score
-2.8547
Total Score
-130.91
Score CDR
-0.5312
Score non-CDR
-0.6042

Calculation Parameters

Chain Sequence(s) EVQLVESGGGLVQPGGSLRLSCAASGFNIDDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGFYAMDVWGQGTLVTVSDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSADFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEI input.pdb
Selected Chain(s) C (Heavy), D (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.8547
Maximum Score 2.1211
Average Score -0.5897
Total Score -130.9137

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E C -1.7156 Soluble
2 V C -0.5829 Soluble
3 Q C -0.7372 Soluble
4 L C 0.0000 Buried
5 V C 0.7186 Aggregation-prone
6 E C 0.0000 Buried
7 S C -0.4398 Soluble
8 G C -0.9253 Soluble
9 G C -0.0703 Soluble
11 G C 0.8456 Aggregation-prone
12 L C 1.3856 Aggregation-prone
13 V C -0.0281 Soluble
14 Q C -1.2988 Soluble
15 P C -1.6625 Soluble
16 G C -1.5040 Soluble
17 G C -1.0330 Soluble
18 S C -1.1349 Soluble
19 L C -1.0191 Soluble
20 R C -2.1087 Soluble
21 L C 0.0000 Buried
22 S C -0.4922 Soluble
23 C C 0.0000 Buried
24 A C -0.3119 Soluble
25 A C 0.0000 Buried
26 S C -0.7201 Soluble
27 G C -0.9326 Soluble
28 F C -1.1334 Soluble
29 N C -2.2171 Soluble
30 I C 0.0000 Buried
35 D C -2.4265 Soluble
36 D C -2.4472 Soluble
37 T C -1.2905 Soluble
38 Y C -0.1898 Soluble
39 I C 0.0000 Buried
40 H C 0.0000 Buried
41 W C 0.0000 Buried
42 V C 0.0000 Buried
43 R C 0.0000 Buried
44 Q C -0.6776 Soluble
45 A C -1.1040 Soluble
46 P C -1.2008 Soluble
47 G C -1.5346 Soluble
48 K C -2.3537 Soluble
49 G C -1.5823 Soluble
50 L C 0.0000 Buried
51 E C -1.1226 Soluble
52 W C 0.0000 Buried
53 V C 0.0000 Buried
54 A C 0.0000 Buried
55 R C 0.0000 Buried
56 I C 0.0000 Buried
57 Y C -0.6399 Soluble
58 P C -1.3018 Soluble
59 T C -1.4149 Soluble
62 N C -1.3984 Soluble
63 G C -1.0346 Soluble
64 Y C -0.3452 Soluble
65 T C -0.6168 Soluble
66 R C -1.6415 Soluble
67 Y C -1.4842 Soluble
68 A C -1.6794 Soluble
69 D C -2.5604 Soluble
70 S C -1.5142 Soluble
71 V C 0.0000 Buried
72 K C -2.6784 Soluble
74 G C -1.6229 Soluble
75 R C 0.0000 Buried
76 F C 0.0000 Buried
77 T C -0.9873 Soluble
78 I C 0.0000 Buried
79 S C -0.3250 Soluble
80 A C -0.9036 Soluble
81 D C -1.6170 Soluble
82 T C -1.8186 Soluble
83 S C -1.6033 Soluble
84 K C -2.2974 Soluble
85 N C -1.8093 Soluble
86 T C 0.0000 Buried
87 A C 0.0000 Buried
88 Y C 0.0000 Buried
89 L C 0.0000 Buried
90 Q C -1.2983 Soluble
91 M C 0.0000 Buried
92 N C -1.4789 Soluble
93 S C -1.2834 Soluble
94 L C 0.0000 Buried
95 R C -2.3774 Soluble
96 A C -1.8001 Soluble
97 E C -2.2743 Soluble
98 D C 0.0000 Buried
99 T C -0.4689 Soluble
100 A C 0.0000 Buried
101 V C 0.4894 Aggregation-prone
102 Y C 0.0000 Buried
103 Y C 0.0000 Buried
104 C C 0.0000 Buried
105 S C 0.0000 Buried
106 R C -0.2729 Soluble
107 W C 0.0000 Buried
108 G C 0.3123 Aggregation-prone
109 F C 2.1211 Aggregation-prone
113 Y C 1.7277 Aggregation-prone
114 A C 0.0000 Buried
115 M C 0.0000 Buried
116 D C -0.2089 Soluble
117 V C -0.4209 Soluble
118 W C 0.0000 Buried
119 G C 0.0000 Buried
120 Q C -1.2273 Soluble
121 G C -0.4529 Soluble
122 T C 0.2217 Aggregation-prone
123 L C 1.5054 Aggregation-prone
124 V C 0.0000 Buried
125 T C 0.3092 Aggregation-prone
126 V C 0.0000 Buried
127 S C -0.5264 Soluble
1 D D -2.2939 Soluble
2 I D 0.0000 Buried
3 Q D -2.3047 Soluble
4 M D 0.0000 Buried
5 T D -1.2941 Soluble
6 Q D 0.0000 Buried
7 S D -0.6764 Soluble
8 P D -0.5995 Soluble
9 S D -0.8207 Soluble
10 S D -0.9818 Soluble
11 L D -0.4188 Soluble
12 S D -0.2037 Soluble
13 A D 0.0122 Aggregation-prone
14 S D 0.1286 Aggregation-prone
15 V D 0.6390 Aggregation-prone
16 G D -0.8743 Soluble
17 D D -1.5233 Soluble
18 R D -2.2956 Soluble
19 V D 0.0000 Buried
20 T D -0.5866 Soluble
21 I D 0.0000 Buried
22 T D -0.8780 Soluble
23 C D 0.0000 Buried
24 R D -2.8204 Soluble
25 A D -2.1863 Soluble
26 S D -2.2291 Soluble
27 Q D -2.8547 Soluble
28 D D -2.7903 Soluble
29 V D 0.0000 Buried
36 N D -1.6927 Soluble
37 T D -1.3064 Soluble
38 A D -0.0826 Soluble
39 V D 0.0000 Buried
40 A D 0.0000 Buried
41 W D 0.0000 Buried
42 Y D 0.0000 Buried
43 Q D 0.0000 Buried
44 Q D 0.0000 Buried
45 K D -1.5887 Soluble
46 P D -1.2505 Soluble
47 G D -1.3802 Soluble
48 K D -2.3774 Soluble
49 A D -1.5931 Soluble
50 P D 0.0000 Buried
51 K D -1.3948 Soluble
52 L D 0.0000 Buried
53 L D 0.0000 Buried
54 I D 0.0000 Buried
55 Y D 0.9796 Aggregation-prone
56 S D 0.2056 Aggregation-prone
57 A D 0.0000 Buried
65 D D -1.0306 Soluble
66 F D 1.4854 Aggregation-prone
67 L D 1.2535 Aggregation-prone
68 Y D 0.7817 Aggregation-prone
69 S D 0.2273 Aggregation-prone
70 G D -0.2881 Soluble
71 V D -0.0514 Soluble
72 P D -0.2192 Soluble
74 S D -0.3754 Soluble
75 R D -0.8169 Soluble
76 F D 0.0000 Buried
77 S D -0.2716 Soluble
78 G D -0.7510 Soluble
79 S D -1.6095 Soluble
80 R D -2.8231 Soluble
83 S D -1.5376 Soluble
84 G D -1.4354 Soluble
85 T D -1.9881 Soluble
86 D D -1.8558 Soluble
87 F D 0.0000 Buried
88 T D -1.2288 Soluble
89 L D 0.0000 Buried
90 T D -0.6006 Soluble
91 I D 0.0000 Buried
92 S D -1.4336 Soluble
93 S D -1.2640 Soluble
94 L D 0.0000 Buried
95 Q D -0.6316 Soluble
96 P D -0.4063 Soluble
97 E D -0.9836 Soluble
98 D D 0.0000 Buried
99 F D 0.0572 Aggregation-prone
100 A D 0.0000 Buried
101 T D 0.0000 Buried
102 Y D 0.0000 Buried
103 Y D 0.0000 Buried
104 C D 0.0000 Buried
105 Q D 0.0000 Buried
106 Q D 0.0000 Buried
107 H D 0.9106 Aggregation-prone
108 Y D 0.6969 Aggregation-prone
109 T D 0.2364 Aggregation-prone
114 T D -0.2180 Soluble
115 P D -0.5596 Soluble
116 P D 0.0000 Buried
117 T D -0.7583 Soluble
118 F D 0.0000 Buried
119 G D 0.0000 Buried
120 Q D -1.6478 Soluble
121 G D 0.0000 Buried
122 T D 0.0000 Buried
123 K D -1.6209 Soluble
124 V D 0.0000 Buried
125 E D -0.3409 Soluble
126 I D 1.2638 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.4532 4.5363 CSV PDB
4.5 -0.4984 4.5269 CSV PDB
5.0 -0.5514 4.5236 CSV PDB
5.5 -0.6048 4.5205 CSV PDB
6.0 -0.6515 4.5162 CSV PDB
6.5 -0.6857 4.5106 CSV PDB
7.0 -0.707 4.5044 CSV PDB
7.5 -0.719 4.4984 CSV PDB
8.0 -0.7251 4.4932 CSV PDB
8.5 -0.7246 4.4894 CSV PDB
9.0 -0.7157 4.4857 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH