Diridavumab / 4evn

A4DAB087_4evn_M_N | Source PDB: 4evn | Chains: M, N | Done
96.55
Yes
10 Å
Yes
Avg A4D Score
-0.6568
Max Score
3.1824
Min Score
-3.1515
Total Score
-285.06
Score CDR
-0.0383
Score non-CDR
-0.7429

Calculation Parameters

Chain Sequence(s) QVQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSAYVVFGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE input.pdb
Selected Chain(s) M (Heavy), N (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.1515
Maximum Score 3.1824
Average Score -0.6568
Total Score -285.0585

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q M -1.4518 Soluble
2 V M -0.9798 Soluble
3 Q M -1.3520 Soluble
4 L M 0.0000 Buried
5 V M 0.4793 Aggregation-prone
6 E M -0.1498 Soluble
7 S M -0.4991 Soluble
8 G M -0.5182 Soluble
9 A M -0.3372 Soluble
11 E M -0.6287 Soluble
12 V M -0.0138 Soluble
13 K M -1.2506 Soluble
14 K M -2.2136 Soluble
15 P M -2.2352 Soluble
16 G M -1.6200 Soluble
17 S M -1.2444 Soluble
18 S M -1.1801 Soluble
19 V M 0.0000 Buried
20 K M -1.9695 Soluble
21 V M 0.0000 Buried
22 S M -0.5455 Soluble
23 C M 0.0000 Buried
24 K M -0.9401 Soluble
25 A M 0.0000 Buried
26 S M -0.7881 Soluble
27 G M -0.9440 Soluble
28 G M -0.4685 Soluble
29 P M 0.3858 Aggregation-prone
30 F M 1.9120 Aggregation-prone
35 R M 0.0000 Buried
36 S M 0.8995 Aggregation-prone
37 Y M 0.9783 Aggregation-prone
38 A M 0.0000 Buried
39 I M 0.0000 Buried
40 S M 0.0000 Buried
41 W M 0.0000 Buried
42 V M 0.0000 Buried
43 R M -0.4451 Soluble
44 Q M -0.7055 Soluble
45 A M -1.0483 Soluble
46 P M -0.8625 Soluble
47 G M -1.4377 Soluble
48 Q M -1.7497 Soluble
49 G M -1.1880 Soluble
50 P M 0.0000 Buried
51 E M -0.7737 Soluble
52 W M 0.0000 Buried
53 M M 0.0000 Buried
54 G M 0.0000 Buried
55 G M 0.0000 Buried
56 I M 0.0000 Buried
57 I M 0.0000 Buried
58 P M 0.0000 Buried
59 I M 3.1824 Aggregation-prone
62 F M 2.7510 Aggregation-prone
63 G M 1.1344 Aggregation-prone
64 T M 0.5242 Aggregation-prone
65 T M -0.2059 Soluble
66 K M -0.8322 Soluble
67 Y M -0.8854 Soluble
68 A M 0.0000 Buried
69 P M -1.2988 Soluble
70 K M -2.2601 Soluble
71 F M 0.0000 Buried
72 Q M -2.1788 Soluble
74 G M -1.5558 Soluble
75 R M -1.4874 Soluble
76 V M 0.0000 Buried
77 T M -0.8266 Soluble
78 I M 0.0000 Buried
79 T M -0.4574 Soluble
80 A M -0.4634 Soluble
81 D M -1.0148 Soluble
82 D M 0.4185 Aggregation-prone
83 F M 1.6211 Aggregation-prone
84 A M 0.3712 Aggregation-prone
85 G M 0.0000 Buried
86 T M -0.3696 Soluble
87 V M 0.0000 Buried
88 Y M -0.6342 Soluble
89 M M 0.0000 Buried
90 E M -1.2784 Soluble
91 L M 0.0000 Buried
92 S M -1.1812 Soluble
93 S M -1.2492 Soluble
94 L M 0.0000 Buried
95 R M -3.0954 Soluble
96 S M -2.3899 Soluble
97 E M -2.5489 Soluble
98 D M 0.0000 Buried
99 T M -0.9722 Soluble
100 A M 0.0000 Buried
101 M M -0.0766 Soluble
102 Y M 0.0000 Buried
103 Y M 0.0000 Buried
104 C M 0.0000 Buried
105 A M 0.0000 Buried
106 K M -0.0748 Soluble
107 H M 0.0000 Buried
108 M M 0.1805 Aggregation-prone
109 G M 0.1564 Aggregation-prone
110 Y M 0.9890 Aggregation-prone
111 Q M -0.5815 Soluble
112A V M 0.0000 Buried
112 R M -1.9930 Soluble
113 E M -1.4887 Soluble
114 T M -0.7233 Soluble
115 M M 0.0000 Buried
116 D M -0.4048 Soluble
117 V M -0.2595 Soluble
118 W M 0.0000 Buried
119 G M 0.0000 Buried
120 K M -1.5123 Soluble
121 G M -0.7637 Soluble
122 T M 0.0000 Buried
123 T M -0.0876 Soluble
124 V M 0.0000 Buried
125 T M -0.7209 Soluble
126 V M 0.0000 Buried
127 S M -1.2230 Soluble
128 S M -1.2734 Soluble
129 A M -0.7649 Soluble
130 S M -0.8602 Soluble
131 T M -0.9547 Soluble
132 K M -1.9676 Soluble
133 G M -1.8488 Soluble
134 P M -0.9917 Soluble
135 S M -0.4569 Soluble
136 V M 0.0000 Buried
137 F M -0.4080 Soluble
138 P M -0.8631 Soluble
139 L M 0.0000 Buried
140 A M -0.8644 Soluble
141 P M 0.0000 Buried
142 S M -0.6950 Soluble
143 S M -0.7107 Soluble
144 K M -1.0739 Soluble
145 S M 0.0000 Buried
146 T M -0.7428 Soluble
147 S M -0.7879 Soluble
148 G M -0.8283 Soluble
149 G M -0.8419 Soluble
150 T M -0.6052 Soluble
151 A M 0.0000 Buried
152 A M 0.0000 Buried
153 L M 0.0000 Buried
154 G M 0.0000 Buried
155 C M 0.0000 Buried
156 L M 0.0000 Buried
157 V M 0.0000 Buried
158 K M -0.5581 Soluble
159 D M -1.0743 Soluble
160 Y M 0.0000 Buried
161 F M 0.0000 Buried
162 P M -0.9738 Soluble
163 E M -1.0521 Soluble
164 P M -1.0006 Soluble
165 V M -0.7643 Soluble
166 T M -0.6290 Soluble
167 V M -0.3033 Soluble
168 S M -0.3596 Soluble
169 W M 0.0000 Buried
170 N M -0.8135 Soluble
171 S M -0.6918 Soluble
172 G M -0.5237 Soluble
173 A M -0.2038 Soluble
174 L M 0.0911 Aggregation-prone
175 T M -0.1211 Soluble
176 S M -0.2441 Soluble
177 G M -0.3122 Soluble
178 V M 0.1645 Aggregation-prone
179 H M -0.2033 Soluble
180 T M -0.0526 Soluble
181 F M 0.0000 Buried
182 P M -0.2471 Soluble
183 A M -0.0154 Soluble
184 V M 0.0000 Buried
185 L M 1.0249 Aggregation-prone
186 Q M 0.0322 Aggregation-prone
187 S M -0.2129 Soluble
188 S M -0.3228 Soluble
189 G M -0.1473 Soluble
190 L M 0.0000 Buried
191 Y M -0.0637 Soluble
192 S M 0.0000 Buried
193 L M 0.0000 Buried
194 S M 0.0000 Buried
195 S M 0.0000 Buried
196 V M 0.0000 Buried
197 V M 0.0000 Buried
198 T M -0.2088 Soluble
199 V M 0.0000 Buried
200 P M -0.6359 Soluble
201 S M -0.6445 Soluble
202 S M -0.6018 Soluble
203 S M -0.6684 Soluble
204 L M -0.8966 Soluble
205 G M -1.1133 Soluble
206 T M -0.7510 Soluble
207 Q M -1.3394 Soluble
208 T M -1.1903 Soluble
209 Y M 0.0000 Buried
210 I M -1.3800 Soluble
211 C M 0.0000 Buried
212 N M -1.5036 Soluble
213 V M 0.0000 Buried
214 N M -1.8700 Soluble
215 H M 0.0000 Buried
216 K M -2.7942 Soluble
217 P M -1.8000 Soluble
218 S M -1.9871 Soluble
219 N M -2.6448 Soluble
220 T M -2.1213 Soluble
221 K M -2.6416 Soluble
222 V M -1.4591 Soluble
223 D M -2.5779 Soluble
224 K M -2.0891 Soluble
225 R M -2.7256 Soluble
226 V M 0.0000 Buried
227 E M -2.5580 Soluble
228 P M -1.2289 Soluble
3 V N 1.6159 Aggregation-prone
4 L N 0.0000 Buried
5 T N 0.0688 Aggregation-prone
6 Q N 0.0000 Buried
7 P N -0.5269 Soluble
8 P N -0.7745 Soluble
9 S N -0.7509 Soluble
11 V N -0.2648 Soluble
12 S N -0.1740 Soluble
13 A N -0.4185 Soluble
14 A N -0.7779 Soluble
15 P N -1.4543 Soluble
16 G N -2.0225 Soluble
17 Q N -2.5805 Soluble
18 K N -2.5908 Soluble
19 V N 0.0000 Buried
20 T N -0.4865 Soluble
21 I N 0.0000 Buried
22 S N -0.2967 Soluble
23 C N 0.0000 Buried
24 S N -0.1542 Soluble
25 G N -0.0587 Soluble
26 S N -0.4022 Soluble
27 S N -0.9038 Soluble
28 S N -0.5566 Soluble
29 N N 0.0000 Buried
30 I N 0.0000 Buried
35 G N -1.0634 Soluble
36 N N -1.3526 Soluble
37 N N -0.7497 Soluble
38 Y N 0.0478 Aggregation-prone
39 V N 0.0000 Buried
40 S N 0.0000 Buried
41 W N 0.0000 Buried
42 Y N 0.0000 Buried
43 Q N 0.0000 Buried
44 Q N -0.6178 Soluble
45 L N -0.2981 Soluble
46 P N -0.5887 Soluble
47 G N -0.7835 Soluble
48 T N -0.8313 Soluble
49 A N -0.9361 Soluble
50 P N 0.0000 Buried
51 K N -0.8101 Soluble
52 L N 0.0000 Buried
53 L N 0.0000 Buried
54 I N 0.0000 Buried
55 Y N -1.2092 Soluble
56 D N -1.5518 Soluble
57 N N -1.4931 Soluble
65 N N -2.5328 Soluble
66 K N -2.8398 Soluble
67 R N -2.2791 Soluble
68 P N -1.1146 Soluble
69 S N -0.9243 Soluble
70 G N -0.8211 Soluble
71 I N -0.8680 Soluble
72 P N -1.2899 Soluble
74 D N -2.2133 Soluble
75 R N -1.5830 Soluble
76 F N 0.0000 Buried
77 S N -1.5106 Soluble
78 G N -1.4607 Soluble
79 S N -1.3292 Soluble
80 K N -1.0146 Soluble
83 S N -0.7718 Soluble
84 G N -0.9970 Soluble
85 T N -0.8734 Soluble
86 S N -0.6311 Soluble
87 A N 0.0000 Buried
88 T N -0.5499 Soluble
89 L N 0.0000 Buried
90 G N -0.6258 Soluble
91 I N 0.0000 Buried
92 T N -1.9674 Soluble
93 G N -1.9020 Soluble
94 L N 0.0000 Buried
95 Q N -1.8636 Soluble
96 T N -1.0167 Soluble
97 G N -0.9540 Soluble
98 D N 0.0000 Buried
99 E N -0.8220 Soluble
100 A N 0.0000 Buried
101 D N -1.0963 Soluble
102 Y N 0.0000 Buried
103 Y N 0.0000 Buried
104 C N 0.0000 Buried
105 G N 0.0000 Buried
106 T N 0.0000 Buried
107 W N 0.0000 Buried
108 D N 0.0000 Buried
109 S N -0.3649 Soluble
110 S N 0.5523 Aggregation-prone
112 L N 1.4295 Aggregation-prone
113 S N 0.4549 Aggregation-prone
114 A N 0.1729 Aggregation-prone
115 Y N -0.0698 Soluble
116 V N 0.0000 Buried
117 V N 0.0000 Buried
118 F N 0.0000 Buried
119 G N 0.0000 Buried
120 G N -0.7576 Soluble
121 G N 0.0000 Buried
122 T N 0.0000 Buried
123 K N -1.4804 Soluble
124 L N 0.0000 Buried
125 T N -0.3537 Soluble
126 V N 0.0000 Buried
127 L N 0.3819 Aggregation-prone
128 G N -0.5440 Soluble
129 Q N -1.1536 Soluble
130 P N -1.4376 Soluble
131 K N -2.5531 Soluble
132 A N -2.0631 Soluble
133 N N -2.1453 Soluble
134 P N 0.0000 Buried
135 T N -0.4652 Soluble
136 V N 0.0000 Buried
137 T N -0.4929 Soluble
138 L N 0.0000 Buried
139 F N 0.0000 Buried
140 P N -0.1074 Soluble
141 P N -0.4711 Soluble
142 S N -0.7100 Soluble
143 S N -1.2330 Soluble
144 E N -1.8188 Soluble
145 E N 0.0000 Buried
146 L N -1.9403 Soluble
147 Q N -2.2184 Soluble
148 A N -1.8604 Soluble
149 N N -2.7609 Soluble
150 K N -2.8545 Soluble
151 A N 0.0000 Buried
152 T N 0.0000 Buried
153 L N 0.0000 Buried
154 V N 0.0000 Buried
155 C N 0.0000 Buried
156 L N 0.0000 Buried
157 I N 0.0000 Buried
158 S N -0.8113 Soluble
159 D N -1.6129 Soluble
160 F N 0.0000 Buried
161 Y N 0.0000 Buried
162 P N -1.2764 Soluble
163 G N -1.1933 Soluble
164 A N -0.4739 Soluble
165 V N -0.3274 Soluble
166 T N -0.0595 Soluble
167 V N 0.0741 Aggregation-prone
168 A N -0.4017 Soluble
169 W N 0.0000 Buried
170 K N -1.1393 Soluble
171 A N -1.5959 Soluble
172 D N -2.2810 Soluble
173 G N -1.5184 Soluble
174 S N -0.9282 Soluble
175 P N -0.9985 Soluble
176 V N -0.8897 Soluble
177 K N -1.6727 Soluble
178 A N -0.8906 Soluble
179 G N -0.7894 Soluble
180 V N -0.6324 Soluble
181 E N -0.7040 Soluble
182 T N -0.5015 Soluble
183 T N -0.8318 Soluble
184 K N -1.7840 Soluble
185 P N -1.2194 Soluble
186 S N -1.3743 Soluble
187 K N -2.1229 Soluble
188 Q N -1.8489 Soluble
189 S N -1.6112 Soluble
190 N N -2.3312 Soluble
191 N N -2.4461 Soluble
192 K N -2.3640 Soluble
193 Y N 0.0000 Buried
194 A N 0.0000 Buried
195 A N 0.0000 Buried
196 S N 0.0000 Buried
197 S N 0.0000 Buried
198 Y N 0.0000 Buried
199 L N 0.0000 Buried
200 S N -0.7486 Soluble
201 L N 0.0000 Buried
202 T N -1.9592 Soluble
203 P N -2.5484 Soluble
204 E N -3.1515 Soluble
205 Q N -2.3387 Soluble
206 W N 0.0000 Buried
207 K N -3.0272 Soluble
208 S N -2.3851 Soluble
209 H N -2.5424 Soluble
210 R N -3.0428 Soluble
211 S N 0.0000 Buried
212 Y N 0.0000 Buried
213 S N 0.0000 Buried
214 C N 0.0000 Buried
215 Q N -0.9069 Soluble
216 V N 0.0000 Buried
217 T N -0.7850 Soluble
218 H N 0.0000 Buried
219 E N -2.5125 Soluble
220 G N -1.3992 Soluble
221 S N -1.0709 Soluble
222 T N -0.8783 Soluble
223 V N -0.7533 Soluble
224 E N -1.6346 Soluble
225 K N -1.4966 Soluble
226 T N -1.0343 Soluble
227 V N 0.0000 Buried
228 A N -1.6144 Soluble
229 P N -1.6558 Soluble
230 T N -1.2124 Soluble
231 E N -2.1385 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.589 6.2872 CSV PDB
4.5 -0.6224 6.2124 CSV PDB
5.0 -0.6599 6.1265 CSV PDB
5.5 -0.6922 6.036 CSV PDB
6.0 -0.7088 5.9438 CSV PDB
6.5 -0.702 5.8513 CSV PDB
7.0 -0.6727 5.7593 CSV PDB
7.5 -0.6297 5.6693 CSV PDB
8.0 -0.5798 5.6381 CSV PDB
8.5 -0.5256 5.6381 CSV PDB
9.0 -0.4673 5.6381 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH