Diridavumab / 8f38

A4DAB087_8f38_E_H | Source PDB: 8f38 | Chains: E, H | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.4849
Max Score
3.0374
Min Score
-2.8594
Total Score
-110.07
Score CDR
-0.2095
Score non-CDR
-0.5688

Calculation Parameters

Chain Sequence(s) VQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRRPTAYVVFGGGTKLTVL input.pdb
Selected Chain(s) E (Heavy), H (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.8594
Maximum Score 3.0374
Average Score -0.4849
Total Score -110.0672

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V E 1.0653 Aggregation-prone
3 Q E -0.3439 Soluble
4 L E 0.0000 Buried
5 V E 0.5651 Aggregation-prone
6 E E -0.0679 Soluble
7 S E -0.4628 Soluble
8 G E -0.4920 Soluble
9 A E -0.1405 Soluble
11 E E 0.0032 Aggregation-prone
12 V E 1.1350 Aggregation-prone
13 K E -0.5374 Soluble
14 K E -1.7963 Soluble
15 P E -1.9062 Soluble
16 G E -1.3950 Soluble
17 S E -1.1045 Soluble
18 S E -1.2776 Soluble
19 V E 0.0000 Buried
20 K E -2.2234 Soluble
21 V E 0.0000 Buried
22 S E -0.5202 Soluble
23 C E 0.0000 Buried
24 K E -0.7553 Soluble
25 A E -0.2007 Soluble
26 S E -0.4031 Soluble
27 G E -0.4736 Soluble
28 G E -0.1574 Soluble
29 P E 0.3370 Aggregation-prone
30 F E 1.6808 Aggregation-prone
35 R E 0.6339 Aggregation-prone
36 S E 0.7042 Aggregation-prone
37 Y E 0.6884 Aggregation-prone
38 A E 0.0000 Buried
39 I E 0.0000 Buried
40 S E 0.0000 Buried
41 W E 0.0000 Buried
42 V E 0.0000 Buried
43 R E 0.0000 Buried
44 Q E 0.0000 Buried
45 A E -0.9918 Soluble
46 P E -0.8349 Soluble
47 G E -1.1951 Soluble
48 Q E -1.7352 Soluble
49 G E -1.1598 Soluble
50 P E 0.0000 Buried
51 E E -1.1035 Soluble
52 W E 0.0000 Buried
53 M E 0.0000 Buried
54 G E 0.0000 Buried
55 G E 0.0000 Buried
56 I E 0.0000 Buried
57 I E 0.7585 Aggregation-prone
58 P E 0.0000 Buried
59 I E 3.0374 Aggregation-prone
62 F E 2.8289 Aggregation-prone
63 G E 1.0869 Aggregation-prone
64 T E 0.3761 Aggregation-prone
65 T E -0.1631 Soluble
66 K E -0.7231 Soluble
67 Y E -0.7472 Soluble
68 A E 0.0000 Buried
69 P E -1.4887 Soluble
70 K E -2.2326 Soluble
71 F E -1.4690 Soluble
72 Q E -2.0561 Soluble
74 G E -1.4617 Soluble
75 R E -1.3699 Soluble
76 V E 0.0000 Buried
77 T E -0.9745 Soluble
78 I E 0.0000 Buried
79 T E -0.5349 Soluble
80 A E -0.6118 Soluble
81 D E -0.9388 Soluble
82 D E -0.1905 Soluble
83 F E 1.3464 Aggregation-prone
84 A E 0.2928 Aggregation-prone
85 G E -0.3251 Soluble
86 T E 0.0000 Buried
87 V E 0.0000 Buried
88 Y E -0.6482 Soluble
89 M E 0.0000 Buried
90 E E -1.9044 Soluble
91 L E 0.0000 Buried
92 S E -1.1480 Soluble
93 S E -0.9952 Soluble
94 L E 0.0000 Buried
95 R E -2.2150 Soluble
96 S E -1.7745 Soluble
97 E E -2.1997 Soluble
98 D E 0.0000 Buried
99 T E -0.4816 Soluble
100 A E 0.0000 Buried
101 M E 0.0024 Aggregation-prone
102 Y E 0.0000 Buried
103 Y E 0.0000 Buried
104 C E 0.0000 Buried
105 A E 0.0000 Buried
106 K E 0.0881 Aggregation-prone
107 H E 0.0000 Buried
108 M E 0.4262 Aggregation-prone
109 G E 0.0857 Aggregation-prone
110 Y E 0.7582 Aggregation-prone
111 Q E -0.8454 Soluble
112A V E 0.0000 Buried
112 R E -0.5821 Soluble
113 E E 0.0000 Buried
114 T E 0.0000 Buried
115 M E 0.0000 Buried
116 D E -0.7296 Soluble
117 V E -0.0916 Soluble
118 W E -0.3727 Soluble
119 G E 0.0000 Buried
120 K E -1.5116 Soluble
121 G E -0.6287 Soluble
122 T E 0.0000 Buried
123 T E 0.0990 Aggregation-prone
124 V E 0.0000 Buried
125 T E 0.0374 Aggregation-prone
126 V E -0.3766 Soluble
3 V H 1.6275 Aggregation-prone
4 L H 0.0000 Buried
5 T H -0.0225 Soluble
6 Q H -0.3823 Soluble
7 P H -0.5702 Soluble
8 P H -0.7564 Soluble
9 S H -0.7496 Soluble
11 V H -0.2144 Soluble
12 S H -0.0673 Soluble
13 A H -0.2014 Soluble
14 A H -0.3269 Soluble
15 P H -1.0251 Soluble
16 G H -1.7558 Soluble
17 Q H -2.2429 Soluble
18 K H -2.4165 Soluble
19 V H 0.0000 Buried
20 T H -0.5078 Soluble
21 I H 0.0000 Buried
22 S H -0.3805 Soluble
23 C H 0.0000 Buried
24 S H -0.2896 Soluble
25 G H -0.0209 Soluble
26 S H -0.3928 Soluble
27 S H -0.9232 Soluble
28 S H -1.1311 Soluble
29 N H 0.0000 Buried
30 I H 0.0000 Buried
35 G H -1.2137 Soluble
36 N H -1.5846 Soluble
37 D H -0.7589 Soluble
38 Y H -0.0727 Soluble
39 V H 0.0000 Buried
40 S H 0.0000 Buried
41 W H 0.0000 Buried
42 Y H 0.0000 Buried
43 Q H -0.7903 Soluble
44 Q H -0.8263 Soluble
45 L H -0.3919 Soluble
46 P H -0.4471 Soluble
47 G H -0.7030 Soluble
48 T H -0.7892 Soluble
49 A H -0.8286 Soluble
50 P H 0.0000 Buried
51 K H -1.5265 Soluble
52 L H 0.0000 Buried
53 L H 0.0000 Buried
54 I H 0.0000 Buried
55 Y H -1.4412 Soluble
56 D H -1.9527 Soluble
57 N H -1.7894 Soluble
65 N H -2.6606 Soluble
66 K H -2.8594 Soluble
67 R H -2.3801 Soluble
68 P H -1.0210 Soluble
69 S H -0.7541 Soluble
70 G H -0.8514 Soluble
71 I H -1.0188 Soluble
72 P H -1.3241 Soluble
74 D H -2.2082 Soluble
75 R H -1.5638 Soluble
76 F H 0.0000 Buried
77 S H -1.4700 Soluble
78 G H -1.4009 Soluble
79 S H -1.3881 Soluble
80 K H -1.1355 Soluble
83 S H -0.8687 Soluble
84 G H -1.0623 Soluble
85 T H -0.9494 Soluble
86 S H -0.7641 Soluble
87 A H 0.0000 Buried
88 T H -0.5103 Soluble
89 L H 0.0000 Buried
90 G H -0.6899 Soluble
91 I H 0.0000 Buried
92 T H -1.7868 Soluble
93 G H -1.4968 Soluble
94 L H 0.0000 Buried
95 Q H -1.6828 Soluble
96 T H -0.9376 Soluble
97 G H -1.1090 Soluble
98 D H 0.0000 Buried
99 E H -1.4021 Soluble
100 A H 0.0000 Buried
101 N H -0.9350 Soluble
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 T H 0.0000 Buried
107 W H -0.4391 Soluble
108 D H -0.9345 Soluble
109 R H -2.1671 Soluble
110 R H -2.4754 Soluble
112 P H -1.4226 Soluble
113 T H -1.0316 Soluble
114 A H -1.0892 Soluble
115 Y H -0.3404 Soluble
116 V H 0.0000 Buried
117 V H 0.4373 Aggregation-prone
118 F H 0.3070 Aggregation-prone
119 G H 0.0566 Aggregation-prone
120 G H -0.4786 Soluble
121 G H -0.9528 Soluble
122 T H 0.0000 Buried
123 K H -1.5385 Soluble
124 L H 0.0000 Buried
125 T H -0.2739 Soluble
126 V H 0.0929 Aggregation-prone
127 L H 1.3124 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.3092 5.8226 CSV PDB
4.5 -0.3371 5.8178 CSV PDB
5.0 -0.3688 5.8178 CSV PDB
5.5 -0.3976 5.8178 CSV PDB
6.0 -0.4151 5.8178 CSV PDB
6.5 -0.414 5.8178 CSV PDB
7.0 -0.3947 5.8178 CSV PDB
7.5 -0.3638 5.8178 CSV PDB
8.0 -0.3268 5.8178 CSV PDB
8.5 -0.2852 5.8177 CSV PDB
9.0 -0.2389 5.8176 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH