Bemarituzumab / 7soc

A4DAB039_7soc_H_L | Source PDB: 7soc | Chains: H, L | Done
67.67
Yes
10 Å
Yes
Avg A4D Score
-0.649
Max Score
1.9879
Min Score
-3.5068
Total Score
-151.21
Score CDR
-0.1761
Score non-CDR
-0.7916

Calculation Parameters

Chain Sequence(s) QVQLVQSGAEVKKPGASVKVSCKASGYPFTSYGISWVRQAPGQGLEWMGWISTYNGNTNYAQKFQGRVTMTTDTSTTTGYMELRRLRSDDTAVYYCARDYTRGAWFGESLIGGFDNWGQGTLVTVSSASIVLTQSPGTLSLSPGERATLSCRASQTVSSTSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQHDTSLTFGGGTKVE input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.5068
Maximum Score 1.9879
Average Score -0.649
Total Score -151.2128

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q H -1.4483 Soluble
2 V H -1.1169 Soluble
3 Q H -1.4893 Soluble
4 L H 0.0000 Buried
5 V H 0.1369 Aggregation-prone
6 Q H -0.1215 Soluble
7 S H -0.6939 Soluble
8 G H -0.6647 Soluble
9 A H -0.0552 Soluble
11 E H -0.4643 Soluble
12 V H 0.8150 Aggregation-prone
13 K H -0.8323 Soluble
14 K H -2.0250 Soluble
15 P H -2.5008 Soluble
16 G H -2.1521 Soluble
17 A H -1.5841 Soluble
18 S H -1.9881 Soluble
19 V H 0.0000 Buried
20 K H -2.1129 Soluble
21 V H 0.0000 Buried
22 S H -0.5064 Soluble
23 C H 0.0000 Buried
24 K H -0.7005 Soluble
25 A H 0.0000 Buried
26 S H -0.8372 Soluble
27 G H -1.0211 Soluble
28 Y H -0.4847 Soluble
29 P H -0.2775 Soluble
30 F H 0.0000 Buried
35 T H 0.2204 Aggregation-prone
36 S H 0.3571 Aggregation-prone
37 Y H 0.4730 Aggregation-prone
38 G H 0.0000 Buried
39 I H 0.0000 Buried
40 S H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H -0.3712 Soluble
44 Q H -0.6002 Soluble
45 A H -0.9023 Soluble
46 P H -0.8707 Soluble
47 G H -1.2227 Soluble
48 Q H -1.7566 Soluble
49 G H -1.0674 Soluble
50 L H 0.0000 Buried
51 E H -0.7909 Soluble
52 W H 0.0000 Buried
53 M H 0.0000 Buried
54 G H 0.0000 Buried
55 W H 0.0000 Buried
56 I H 0.0000 Buried
57 S H 0.0000 Buried
58 T H 0.0000 Buried
59 Y H 0.4537 Aggregation-prone
62 N H -0.9321 Soluble
63 G H -1.4075 Soluble
64 N H -1.5436 Soluble
65 T H -1.1790 Soluble
66 N H -1.1289 Soluble
67 Y H -1.0698 Soluble
68 A H -1.4902 Soluble
69 Q H -2.5420 Soluble
70 K H -2.7241 Soluble
71 F H 0.0000 Buried
72 Q H -2.4208 Soluble
74 G H -1.8522 Soluble
75 R H -1.9742 Soluble
76 V H 0.0000 Buried
77 T H -0.7751 Soluble
78 M H 0.0000 Buried
79 T H -0.4567 Soluble
80 T H -0.4968 Soluble
81 D H -0.8898 Soluble
82 T H -0.4266 Soluble
83 S H -0.5210 Soluble
84 T H -0.5766 Soluble
85 T H -0.6381 Soluble
86 T H 0.0000 Buried
87 G H 0.0000 Buried
88 Y H -0.4413 Soluble
89 M H 0.0000 Buried
90 E H -1.4486 Soluble
91 L H 0.0000 Buried
92 R H -2.4850 Soluble
93 R H -3.0732 Soluble
94 L H 0.0000 Buried
95 R H -3.5068 Soluble
96 S H -2.3679 Soluble
97 D H -2.5355 Soluble
98 D H 0.0000 Buried
99 T H -0.6687 Soluble
100 A H 0.0000 Buried
101 V H 0.3966 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 R H -0.2785 Soluble
107 D H 0.0000 Buried
108 Y H 0.8121 Aggregation-prone
109 T H 0.0000 Buried
110 R H -0.2870 Soluble
111 G H 0.0000 Buried
111A A H 0.0000 Buried
111B W H 1.5157 Aggregation-prone
111C F H 1.6265 Aggregation-prone
112D G H -0.3061 Soluble
112C E H -1.3363 Soluble
112B S H -0.7214 Soluble
112A L H 0.4516 Aggregation-prone
112 I H 1.9879 Aggregation-prone
113 G H 0.0000 Buried
114 G H 0.0000 Buried
115 F H 0.0000 Buried
116 D H -0.5745 Soluble
117 N H -0.7956 Soluble
118 W H -0.7372 Soluble
119 G H 0.0000 Buried
120 Q H -1.2448 Soluble
121 G H -0.4551 Soluble
122 T H 0.0000 Buried
123 L H 0.6122 Aggregation-prone
124 V H 0.0000 Buried
125 T H -0.2116 Soluble
126 V H 0.0000 Buried
127 S H -1.0599 Soluble
128 S H -0.9010 Soluble
129 A H -0.2810 Soluble
130 S H -0.2610 Soluble
2 I L 0.3581 Aggregation-prone
3 V L 1.3563 Aggregation-prone
4 L L 0.0000 Buried
5 T L -0.4805 Soluble
6 Q L -0.9722 Soluble
7 S L -0.9526 Soluble
8 P L -0.6776 Soluble
9 G L -0.9278 Soluble
10 T L -1.0221 Soluble
11 L L -0.7561 Soluble
12 S L -0.8637 Soluble
13 L L -0.9774 Soluble
14 S L -1.4341 Soluble
15 P L -2.0006 Soluble
16 G L -2.1844 Soluble
17 E L -2.9918 Soluble
18 R L -3.3661 Soluble
19 A L 0.0000 Buried
20 T L -0.6429 Soluble
21 L L 0.0000 Buried
22 S L -1.0253 Soluble
23 C L 0.0000 Buried
24 R L -2.3371 Soluble
25 A L -1.1796 Soluble
26 S L -0.7013 Soluble
27 Q L -1.3310 Soluble
28 T L -1.3768 Soluble
29 V L 0.0000 Buried
30 S L -0.7465 Soluble
36 S L -0.4999 Soluble
37 T L 0.2036 Aggregation-prone
38 S L 0.0000 Buried
39 L L 0.0000 Buried
40 A L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L -1.0355 Soluble
45 K L -1.7547 Soluble
46 P L -1.1638 Soluble
47 G L -1.5239 Soluble
48 Q L -2.1024 Soluble
49 A L -1.3745 Soluble
50 P L 0.0000 Buried
51 R L -1.0787 Soluble
52 L L 0.0000 Buried
53 L L 0.0000 Buried
54 I L 0.0000 Buried
55 Y L 0.4057 Aggregation-prone
56 G L 0.4275 Aggregation-prone
57 A L 0.0000 Buried
65 S L -0.5470 Soluble
66 S L -0.2846 Soluble
67 R L -1.0534 Soluble
68 A L -0.7248 Soluble
69 T L -0.4746 Soluble
70 G L -0.7254 Soluble
71 I L -0.7899 Soluble
72 P L -1.1745 Soluble
74 D L -2.1161 Soluble
75 R L -1.9171 Soluble
76 F L 0.0000 Buried
77 S L -0.8429 Soluble
78 G L -0.4250 Soluble
79 S L -0.7342 Soluble
80 G L -1.1841 Soluble
83 S L -1.1861 Soluble
84 G L -1.3218 Soluble
85 T L -1.9230 Soluble
86 D L -2.7524 Soluble
87 F L 0.0000 Buried
88 T L -0.8984 Soluble
89 L L 0.0000 Buried
90 T L -0.8020 Soluble
91 I L 0.0000 Buried
92 S L -2.3534 Soluble
93 R L -3.4692 Soluble
94 L L 0.0000 Buried
95 E L -2.4994 Soluble
96 P L -1.6816 Soluble
97 E L -2.0974 Soluble
98 D L 0.0000 Buried
99 F L -1.1873 Soluble
100 A L 0.0000 Buried
101 V L -0.4874 Soluble
102 Y L 0.0000 Buried
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 Q L 0.0000 Buried
106 Q L 0.0000 Buried
107 H L 0.0000 Buried
108 D L -1.3443 Soluble
114 T L -0.6335 Soluble
115 S L -0.6060 Soluble
116 L L 0.0000 Buried
117 T L 0.1924 Aggregation-prone
118 F L 0.2675 Aggregation-prone
119 G L 0.0000 Buried
120 G L -0.6859 Soluble
121 G L -0.8093 Soluble
122 T L 0.0000 Buried
123 K L -1.4640 Soluble
124 V L 0.0000 Buried
125 E L -1.9238 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.5719 5.2498 CSV PDB
4.5 -0.6102 5.178 CSV PDB
5.0 -0.6559 5.0673 CSV PDB
5.5 -0.7019 4.9354 CSV PDB
6.0 -0.7411 4.8636 CSV PDB
6.5 -0.7679 4.8082 CSV PDB
7.0 -0.7801 4.7721 CSV PDB
7.5 -0.7809 4.7547 CSV PDB
8.0 -0.7739 4.748 CSV PDB
8.5 -0.7604 4.7456 CSV PDB
9.0 -0.7406 4.7445 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH