Diridavumab / 4evn

A4DAB087_4evn_C_D | Source PDB: 4evn | Chains: C, D | Done
96.55
Yes
10 Å
Yes
Avg A4D Score
-0.6584
Max Score
3.1529
Min Score
-3.1536
Total Score
-285.72
Score CDR
-0.0188
Score non-CDR
-0.7473

Calculation Parameters

Chain Sequence(s) QVQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSAYVVFGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE input.pdb
Selected Chain(s) C (Heavy), D (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.1536
Maximum Score 3.1529
Average Score -0.6584
Total Score -285.7245

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q C -1.4402 Soluble
2 V C -0.9477 Soluble
3 Q C -1.1697 Soluble
4 L C 0.0000 Buried
5 V C 0.4805 Aggregation-prone
6 E C -0.1447 Soluble
7 S C -0.5119 Soluble
8 G C -0.5135 Soluble
9 A C -0.3934 Soluble
11 E C -0.8133 Soluble
12 V C -0.3035 Soluble
13 K C -1.4492 Soluble
14 K C -2.3482 Soluble
15 P C -2.3141 Soluble
16 G C -1.6514 Soluble
17 S C -1.2982 Soluble
18 S C -1.2708 Soluble
19 V C 0.0000 Buried
20 K C -2.1238 Soluble
21 V C 0.0000 Buried
22 S C -0.6480 Soluble
23 C C 0.0000 Buried
24 K C -1.0168 Soluble
25 A C 0.0000 Buried
26 S C -0.8014 Soluble
27 G C -0.9352 Soluble
28 G C -0.4943 Soluble
29 P C 0.3304 Aggregation-prone
30 F C 1.9725 Aggregation-prone
35 R C 0.0000 Buried
36 S C 0.8950 Aggregation-prone
37 Y C 0.9632 Aggregation-prone
38 A C 0.0000 Buried
39 I C 0.0000 Buried
40 S C 0.0000 Buried
41 W C 0.0000 Buried
42 V C 0.0000 Buried
43 R C -0.4141 Soluble
44 Q C -0.6768 Soluble
45 A C -1.0312 Soluble
46 P C -0.8488 Soluble
47 G C -1.2682 Soluble
48 Q C -1.7573 Soluble
49 G C -1.2291 Soluble
50 P C -0.7424 Soluble
51 E C -0.7888 Soluble
52 W C 0.0000 Buried
53 M C 0.0000 Buried
54 G C 0.0000 Buried
55 G C 0.0000 Buried
56 I C 0.0000 Buried
57 I C 0.0000 Buried
58 P C 0.0000 Buried
59 I C 3.1529 Aggregation-prone
62 F C 2.7562 Aggregation-prone
63 G C 1.1103 Aggregation-prone
64 T C 0.5134 Aggregation-prone
65 T C -0.2597 Soluble
66 K C -0.9494 Soluble
67 Y C -0.9119 Soluble
68 A C 0.0000 Buried
69 P C -1.3113 Soluble
70 K C -2.2617 Soluble
71 F C 0.0000 Buried
72 Q C -2.1889 Soluble
74 G C -1.5538 Soluble
75 R C -1.5304 Soluble
76 V C 0.0000 Buried
77 T C -0.9562 Soluble
78 I C 0.0000 Buried
79 T C -0.3535 Soluble
80 A C -0.0652 Soluble
81 D C -0.1050 Soluble
82 D C 0.6905 Aggregation-prone
83 F C 1.8201 Aggregation-prone
84 A C 0.5758 Aggregation-prone
85 G C 0.0000 Buried
86 T C -0.1530 Soluble
87 V C 0.0000 Buried
88 Y C -0.6814 Soluble
89 M C 0.0000 Buried
90 E C -1.5826 Soluble
91 L C 0.0000 Buried
92 S C -1.2787 Soluble
93 S C -1.2859 Soluble
94 L C 0.0000 Buried
95 R C -3.1194 Soluble
96 S C -2.4009 Soluble
97 E C -2.5517 Soluble
98 D C 0.0000 Buried
99 T C -0.9940 Soluble
100 A C 0.0000 Buried
101 M C 0.0253 Aggregation-prone
102 Y C 0.0000 Buried
103 Y C 0.0000 Buried
104 C C 0.0000 Buried
105 A C 0.0000 Buried
106 K C -0.0486 Soluble
107 H C 0.0000 Buried
108 M C 0.2041 Aggregation-prone
109 G C 0.1686 Aggregation-prone
110 Y C 0.9748 Aggregation-prone
111 Q C -0.6158 Soluble
112A V C 0.0000 Buried
112 R C -1.9011 Soluble
113 E C -1.3763 Soluble
114 T C -0.6653 Soluble
115 M C 0.0000 Buried
116 D C -0.3327 Soluble
117 V C -0.1923 Soluble
118 W C 0.0000 Buried
119 G C 0.0000 Buried
120 K C -1.3325 Soluble
121 G C 0.0000 Buried
122 T C 0.0000 Buried
123 T C -0.0786 Soluble
124 V C 0.0000 Buried
125 T C -0.8057 Soluble
126 V C 0.0000 Buried
127 S C -1.2931 Soluble
128 S C -1.1452 Soluble
129 A C -0.8306 Soluble
130 S C -0.8947 Soluble
131 T C -0.9248 Soluble
132 K C -1.8018 Soluble
133 G C -1.8006 Soluble
134 P C -0.9754 Soluble
135 S C -0.4324 Soluble
136 V C 0.0000 Buried
137 F C -0.4508 Soluble
138 P C -0.8882 Soluble
139 L C 0.0000 Buried
140 A C -0.8948 Soluble
141 P C 0.0000 Buried
142 S C -1.0838 Soluble
143 S C -1.2825 Soluble
144 K C -2.0865 Soluble
145 S C -1.2316 Soluble
146 T C -1.1430 Soluble
147 S C -0.9804 Soluble
148 G C -1.0198 Soluble
149 G C -0.7511 Soluble
150 T C -0.5648 Soluble
151 A C 0.0000 Buried
152 A C -0.3513 Soluble
153 L C 0.0000 Buried
154 G C 0.0000 Buried
155 C C 0.0000 Buried
156 L C 0.0000 Buried
157 V C 0.0000 Buried
158 K C -0.5584 Soluble
159 D C -1.0250 Soluble
160 Y C 0.0000 Buried
161 F C 0.0000 Buried
162 P C 0.0000 Buried
163 E C -1.0319 Soluble
164 P C -1.0144 Soluble
165 V C -0.8256 Soluble
166 T C -0.7216 Soluble
167 V C -0.4290 Soluble
168 S C -0.4089 Soluble
169 W C 0.0000 Buried
170 N C -0.8656 Soluble
171 S C -0.7112 Soluble
172 G C -0.5369 Soluble
173 A C -0.2178 Soluble
174 L C 0.0850 Aggregation-prone
175 T C -0.1308 Soluble
176 S C -0.2499 Soluble
177 G C -0.3240 Soluble
178 V C 0.1322 Aggregation-prone
179 H C -0.2168 Soluble
180 T C -0.0603 Soluble
181 F C 0.0000 Buried
182 P C -0.2543 Soluble
183 A C -0.0128 Soluble
184 V C 0.0000 Buried
185 L C 1.0929 Aggregation-prone
186 Q C 0.1135 Aggregation-prone
187 S C -0.1761 Soluble
188 S C -0.3254 Soluble
189 G C -0.1651 Soluble
190 L C 0.0000 Buried
191 Y C -0.0485 Soluble
192 S C 0.0000 Buried
193 L C 0.0000 Buried
194 S C 0.0000 Buried
195 S C 0.0000 Buried
196 V C 0.0000 Buried
197 V C 0.0000 Buried
198 T C -0.2149 Soluble
199 V C 0.0000 Buried
200 P C -0.5828 Soluble
201 S C -0.6148 Soluble
202 S C -0.6093 Soluble
203 S C -0.6325 Soluble
204 L C -0.8392 Soluble
205 G C -1.0868 Soluble
206 T C -0.7260 Soluble
207 Q C -1.2931 Soluble
208 T C -1.1864 Soluble
209 Y C 0.0000 Buried
210 I C -1.3853 Soluble
211 C C 0.0000 Buried
212 N C -1.5584 Soluble
213 V C 0.0000 Buried
214 N C -2.1388 Soluble
215 H C 0.0000 Buried
216 K C -2.8878 Soluble
217 P C -1.8558 Soluble
218 S C -2.0002 Soluble
219 N C -2.6912 Soluble
220 T C -2.3688 Soluble
221 K C -2.7512 Soluble
222 V C -1.5455 Soluble
223 D C -2.6379 Soluble
224 K C -2.1302 Soluble
225 R C -2.7473 Soluble
226 V C 0.0000 Buried
227 E C -2.5720 Soluble
228 P C -1.2601 Soluble
3 V D 1.6077 Aggregation-prone
4 L D 0.0000 Buried
5 T D 0.0542 Aggregation-prone
6 Q D 0.0000 Buried
7 P D -0.5936 Soluble
8 P D -0.9398 Soluble
9 S D -0.9803 Soluble
11 V D -0.3675 Soluble
12 S D -0.1525 Soluble
13 A D 0.0000 Buried
14 A D -0.5745 Soluble
15 P D -1.3165 Soluble
16 G D -1.9891 Soluble
17 Q D -2.6039 Soluble
18 K D -2.6012 Soluble
19 V D 0.0000 Buried
20 T D -0.4658 Soluble
21 I D 0.0000 Buried
22 S D -0.2875 Soluble
23 C D 0.0000 Buried
24 S D -0.1652 Soluble
25 G D -0.0964 Soluble
26 S D -0.4467 Soluble
27 S D -0.8883 Soluble
28 S D -0.5077 Soluble
29 N D 0.0000 Buried
30 I D 0.0000 Buried
35 G D -1.0121 Soluble
36 N D -1.2409 Soluble
37 N D 0.0000 Buried
38 Y D 0.1437 Aggregation-prone
39 V D 0.0000 Buried
40 S D 0.0000 Buried
41 W D 0.0000 Buried
42 Y D 0.0000 Buried
43 Q D 0.0000 Buried
44 Q D 0.0000 Buried
45 L D -0.3274 Soluble
46 P D -0.5739 Soluble
47 G D -0.7611 Soluble
48 T D -0.7952 Soluble
49 A D -0.8841 Soluble
50 P D 0.0000 Buried
51 K D -0.7473 Soluble
52 L D 0.0000 Buried
53 L D 0.0000 Buried
54 I D 0.0000 Buried
55 Y D -1.1970 Soluble
56 D D -1.5583 Soluble
57 N D -1.5121 Soluble
65 N D -2.5333 Soluble
66 K D -2.7881 Soluble
67 R D -2.2020 Soluble
68 P D -1.0753 Soluble
69 S D -0.9110 Soluble
70 G D -0.8211 Soluble
71 I D -0.8626 Soluble
72 P D -1.2875 Soluble
74 D D -2.2115 Soluble
75 R D -1.5900 Soluble
76 F D 0.0000 Buried
77 S D -1.4793 Soluble
78 G D -1.4781 Soluble
79 S D -1.3739 Soluble
80 K D -1.0995 Soluble
83 S D -0.8116 Soluble
84 G D -1.0201 Soluble
85 T D -0.8805 Soluble
86 S D -0.6627 Soluble
87 A D 0.0000 Buried
88 T D -0.5538 Soluble
89 L D 0.0000 Buried
90 G D 0.0000 Buried
91 I D 0.0000 Buried
92 T D -1.9685 Soluble
93 G D -1.9168 Soluble
94 L D 0.0000 Buried
95 Q D -1.8496 Soluble
96 T D -0.9795 Soluble
97 G D -0.9336 Soluble
98 D D 0.0000 Buried
99 E D -1.0909 Soluble
100 A D 0.0000 Buried
101 D D -1.6065 Soluble
102 Y D 0.0000 Buried
103 Y D 0.0000 Buried
104 C D 0.0000 Buried
105 G D 0.0000 Buried
106 T D 0.0000 Buried
107 W D -0.4601 Soluble
108 D D 0.0000 Buried
109 S D -0.2767 Soluble
110 S D 0.5738 Aggregation-prone
112 L D 1.4336 Aggregation-prone
113 S D 0.4599 Aggregation-prone
114 A D 0.2017 Aggregation-prone
115 Y D -0.0406 Soluble
116 V D 0.0000 Buried
117 V D 0.0000 Buried
118 F D 0.0000 Buried
119 G D 0.0000 Buried
120 G D -0.8773 Soluble
121 G D -1.2862 Soluble
122 T D 0.0000 Buried
123 K D -2.1999 Soluble
124 L D 0.0000 Buried
125 T D -0.3686 Soluble
126 V D 0.0547 Aggregation-prone
127 L D 1.0004 Aggregation-prone
128 G D -0.3489 Soluble
129 Q D -0.9725 Soluble
130 P D -1.4356 Soluble
131 K D -2.5996 Soluble
132 A D -1.9657 Soluble
133 N D -2.1074 Soluble
134 P D 0.0000 Buried
135 T D -0.4676 Soluble
136 V D 0.0000 Buried
137 T D -0.6169 Soluble
138 L D 0.0000 Buried
139 F D 0.0000 Buried
140 P D -0.1585 Soluble
141 P D -0.5238 Soluble
142 S D -0.7709 Soluble
143 S D -1.3100 Soluble
144 E D -1.9580 Soluble
145 E D 0.0000 Buried
146 L D -2.0084 Soluble
147 Q D -2.2813 Soluble
148 A D -1.9013 Soluble
149 N D -2.7891 Soluble
150 K D -2.8803 Soluble
151 A D 0.0000 Buried
152 T D 0.0000 Buried
153 L D 0.0000 Buried
154 V D 0.0000 Buried
155 C D 0.0000 Buried
156 L D 0.0000 Buried
157 I D 0.0000 Buried
158 S D -0.6985 Soluble
159 D D -1.4628 Soluble
160 F D 0.0000 Buried
161 Y D -1.5697 Soluble
162 P D -1.2417 Soluble
163 G D -0.9580 Soluble
164 A D -0.4034 Soluble
165 V D -0.2743 Soluble
166 T D -0.0394 Soluble
167 V D 0.2169 Aggregation-prone
168 A D -0.3517 Soluble
169 W D 0.0000 Buried
170 K D -1.0090 Soluble
171 A D -1.2743 Soluble
172 D D -1.5480 Soluble
173 G D -1.1768 Soluble
174 S D -0.7463 Soluble
175 P D -0.9145 Soluble
176 V D -0.8085 Soluble
177 K D -1.6328 Soluble
178 A D -0.8291 Soluble
179 G D -0.6695 Soluble
180 V D -0.4513 Soluble
181 E D -0.4614 Soluble
182 T D -0.3731 Soluble
183 T D -0.7833 Soluble
184 K D -1.7405 Soluble
185 P D -1.0761 Soluble
186 S D -1.0888 Soluble
187 K D -1.5517 Soluble
188 Q D -1.5448 Soluble
189 S D -1.4456 Soluble
190 N D -2.1780 Soluble
191 N D -2.1359 Soluble
192 K D -2.0265 Soluble
193 Y D -1.0530 Soluble
194 A D 0.0000 Buried
195 A D 0.0000 Buried
196 S D 0.0000 Buried
197 S D 0.0000 Buried
198 Y D 0.0000 Buried
199 L D 0.0000 Buried
200 S D -0.6871 Soluble
201 L D 0.0000 Buried
202 T D -1.9622 Soluble
203 P D -2.5601 Soluble
204 E D -3.1536 Soluble
205 Q D -2.3335 Soluble
206 W D 0.0000 Buried
207 K D -3.0253 Soluble
208 S D -2.3776 Soluble
209 H D -2.3396 Soluble
210 R D -2.8305 Soluble
211 S D -1.8647 Soluble
212 Y D 0.0000 Buried
213 S D 0.0000 Buried
214 C D 0.0000 Buried
215 Q D -0.7253 Soluble
216 V D 0.0000 Buried
217 T D -0.7157 Soluble
218 H D 0.0000 Buried
219 E D -2.4798 Soluble
220 G D -1.3846 Soluble
221 S D -1.0356 Soluble
222 T D -0.7834 Soluble
223 V D -0.5799 Soluble
224 E D -1.3135 Soluble
225 K D -1.4391 Soluble
226 T D -1.0023 Soluble
227 V D 0.0000 Buried
228 A D -1.5510 Soluble
229 P D -1.6734 Soluble
230 T D -1.2237 Soluble
231 E D -2.1468 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6077 6.2391 CSV PDB
4.5 -0.6383 6.1696 CSV PDB
5.0 -0.6731 6.0943 CSV PDB
5.5 -0.7029 6.0169 CSV PDB
6.0 -0.7171 5.9388 CSV PDB
6.5 -0.7073 5.8607 CSV PDB
7.0 -0.6743 5.7834 CSV PDB
7.5 -0.6267 5.7086 CSV PDB
8.0 -0.5718 5.6403 CSV PDB
8.5 -0.5125 5.6325 CSV PDB
9.0 -0.4497 5.6325 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH