Diridavumab / 8dis

A4DAB087_8dis_H_L | Source PDB: 8dis | Chains: H, L | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5174
Max Score
2.8971
Min Score
-3.0454
Total Score
-117.97
Score CDR
-0.2289
Score non-CDR
-0.6048

Calculation Parameters

Chain Sequence(s) VQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRRPTAYVVFGGGTKLTVL input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.0454
Maximum Score 2.8971
Average Score -0.5174
Total Score -117.9688

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V H 1.0640 Aggregation-prone
3 Q H -0.7011 Soluble
4 L H 0.0000 Buried
5 V H -0.6204 Soluble
6 E H 0.0000 Buried
7 S H -0.7610 Soluble
8 G H -0.6828 Soluble
9 A H -0.3118 Soluble
11 E H -0.5601 Soluble
12 V H 0.6450 Aggregation-prone
13 K H -0.8946 Soluble
14 K H -2.1214 Soluble
15 P H -2.1719 Soluble
16 G H -1.5254 Soluble
17 S H -1.1836 Soluble
18 S H -1.2624 Soluble
19 V H 0.0000 Buried
20 K H -1.9343 Soluble
21 V H 0.0000 Buried
22 S H -0.6189 Soluble
23 C H 0.0000 Buried
24 K H -1.6438 Soluble
25 A H -0.7444 Soluble
26 S H -0.7173 Soluble
27 G H -0.5603 Soluble
28 G H -0.2407 Soluble
29 P H 0.0454 Aggregation-prone
30 F H 1.4046 Aggregation-prone
35 R H 0.4310 Aggregation-prone
36 S H 0.7108 Aggregation-prone
37 Y H 0.7707 Aggregation-prone
38 A H 0.0000 Buried
39 I H 0.0000 Buried
40 S H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H 0.0000 Buried
44 Q H 0.0000 Buried
45 A H -0.8687 Soluble
46 P H -0.7935 Soluble
47 G H -1.1925 Soluble
48 Q H -1.6808 Soluble
49 G H -1.0932 Soluble
50 P H 0.0000 Buried
51 E H -0.4516 Soluble
52 W H 0.0000 Buried
53 M H 0.0000 Buried
54 G H 0.0000 Buried
55 G H 0.0000 Buried
56 I H 0.0000 Buried
57 I H 0.0000 Buried
58 P H 1.3888 Aggregation-prone
59 I H 2.8971 Aggregation-prone
62 F H 2.7745 Aggregation-prone
63 G H 1.0952 Aggregation-prone
64 T H 0.3897 Aggregation-prone
65 T H -0.1680 Soluble
66 K H -0.5923 Soluble
67 Y H -0.6524 Soluble
68 A H 0.0000 Buried
69 P H -1.3240 Soluble
70 K H -2.1521 Soluble
71 F H 0.0000 Buried
72 Q H -2.0287 Soluble
74 G H -1.4518 Soluble
75 R H -1.1646 Soluble
76 V H 0.0000 Buried
77 T H -0.6771 Soluble
78 I H 0.0000 Buried
79 T H -0.5366 Soluble
80 A H -0.9684 Soluble
81 D H -1.5796 Soluble
82 D H -0.9535 Soluble
83 F H 0.9102 Aggregation-prone
84 A H -0.1891 Soluble
85 G H -0.8370 Soluble
86 T H -0.9208 Soluble
87 V H 0.0000 Buried
88 Y H -0.4552 Soluble
89 M H 0.0000 Buried
90 E H -1.1415 Soluble
91 L H 0.0000 Buried
92 S H -1.0150 Soluble
93 S H -0.9784 Soluble
94 L H 0.0000 Buried
95 R H -2.7359 Soluble
96 S H -2.2971 Soluble
97 E H -2.4420 Soluble
98 D H 0.0000 Buried
99 T H -0.7411 Soluble
100 A H 0.0000 Buried
101 M H -0.0083 Soluble
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 K H 0.1243 Aggregation-prone
107 H H 0.0000 Buried
108 M H 0.5598 Aggregation-prone
109 G H 0.3171 Aggregation-prone
110 Y H 0.9996 Aggregation-prone
111 Q H -0.4276 Soluble
112A V H 0.0000 Buried
112 R H -0.4581 Soluble
113 E H 0.0000 Buried
114 T H 0.0000 Buried
115 M H 0.0000 Buried
116 D H -0.6190 Soluble
117 V H 0.0084 Aggregation-prone
118 W H -0.4670 Soluble
119 G H -0.8781 Soluble
120 K H -1.7166 Soluble
121 G H -0.8352 Soluble
122 T H 0.0000 Buried
123 T H -0.0004 Soluble
124 V H 0.0000 Buried
125 T H -0.2699 Soluble
126 V H 0.0000 Buried
127 S H -0.9960 Soluble
3 V L 1.6359 Aggregation-prone
4 L L 0.0000 Buried
5 T L 0.0658 Aggregation-prone
6 Q L 0.0000 Buried
7 P L -0.6034 Soluble
8 P L -0.9287 Soluble
9 S L -1.0288 Soluble
11 V L -0.5307 Soluble
12 S L -0.0855 Soluble
13 A L -0.2071 Soluble
14 A L -0.3975 Soluble
15 P L -0.9510 Soluble
16 G L -1.8076 Soluble
17 Q L -2.3180 Soluble
18 K L -2.4843 Soluble
19 V L 0.0000 Buried
20 T L -0.5094 Soluble
21 I L 0.0000 Buried
22 S L -0.3033 Soluble
23 C L 0.0000 Buried
24 S L -0.1935 Soluble
25 G L 0.0111 Aggregation-prone
26 S L -0.2944 Soluble
27 S L -0.8079 Soluble
28 S L -1.2176 Soluble
29 N L 0.0000 Buried
30 I L 0.0000 Buried
35 G L -1.1399 Soluble
36 N L -1.7249 Soluble
37 D L -1.0091 Soluble
38 Y L -0.2350 Soluble
39 V L 0.0000 Buried
40 S L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L -0.4657 Soluble
45 L L -0.1203 Soluble
46 P L -0.3836 Soluble
47 G L -0.4468 Soluble
48 T L -0.6412 Soluble
49 A L -0.6524 Soluble
50 P L 0.0000 Buried
51 K L -1.0068 Soluble
52 L L 0.0000 Buried
53 L L 0.0000 Buried
54 I L 0.0000 Buried
55 Y L -1.2857 Soluble
56 D L -1.6862 Soluble
57 N L -1.6024 Soluble
65 N L -2.4666 Soluble
66 K L -2.5842 Soluble
67 R L -2.1173 Soluble
68 P L -0.9070 Soluble
69 S L -0.5676 Soluble
70 G L -0.7958 Soluble
71 I L -0.7636 Soluble
72 P L -1.2522 Soluble
74 D L -2.1781 Soluble
75 R L -1.5544 Soluble
76 F L 0.0000 Buried
77 S L -1.3536 Soluble
78 G L -1.2295 Soluble
79 S L -1.1751 Soluble
80 K L -0.9555 Soluble
83 S L -0.7501 Soluble
84 G L -0.9687 Soluble
85 T L -0.8599 Soluble
86 S L -0.6147 Soluble
87 A L 0.0000 Buried
88 T L -0.5449 Soluble
89 L L 0.0000 Buried
90 G L -0.6770 Soluble
91 I L 0.0000 Buried
92 T L -1.8812 Soluble
93 G L -1.8435 Soluble
94 L L 0.0000 Buried
95 Q L -1.6684 Soluble
96 T L -0.9120 Soluble
97 G L -1.0200 Soluble
98 D L 0.0000 Buried
99 E L -1.4184 Soluble
100 A L -0.9772 Soluble
101 N L -1.1901 Soluble
102 Y L 0.0000 Buried
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 A L 0.0000 Buried
106 T L 0.0000 Buried
107 W L 0.0000 Buried
108 D L -1.4049 Soluble
109 R L -3.0454 Soluble
110 R L -2.9209 Soluble
112 P L -1.6131 Soluble
113 T L -1.2747 Soluble
114 A L -1.3660 Soluble
115 Y L -0.4854 Soluble
116 V L 0.0000 Buried
117 V L 0.4230 Aggregation-prone
118 F L 0.3827 Aggregation-prone
119 G L 0.0794 Aggregation-prone
120 G L -0.5702 Soluble
121 G L -1.1212 Soluble
122 T L 0.0000 Buried
123 K L -2.0946 Soluble
124 L L 0.0000 Buried
125 T L -0.3750 Soluble
126 V L 0.0660 Aggregation-prone
127 L L 1.4127 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.3784 5.824 CSV PDB
4.5 -0.4063 5.824 CSV PDB
5.0 -0.4379 5.824 CSV PDB
5.5 -0.4663 5.824 CSV PDB
6.0 -0.4835 5.824 CSV PDB
6.5 -0.4839 5.824 CSV PDB
7.0 -0.4676 5.824 CSV PDB
7.5 -0.4406 5.824 CSV PDB
8.0 -0.4076 5.824 CSV PDB
8.5 -0.3701 5.8239 CSV PDB
9.0 -0.3273 5.8238 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH