Diridavumab / 6uyn

A4DAB087_6uyn_H_L | Source PDB: 6uyn | Chains: H, L | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.4895
Max Score
3.0301
Min Score
-3.1083
Total Score
-145.39
Score CDR
-0.2697
Score non-CDR
-0.5373

Calculation Parameters

Chain Sequence(s) EVQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSSASTKGPSKDYFPEPPAVLQSSGLYSLSVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRRPTAYVVFGGGTKLTVLEELQANKATLVCLISDFYGVETTTPSKQSNNKYAASSYLS input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.1083
Maximum Score 3.0301
Average Score -0.4895
Total Score -145.3879

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E H -1.9904 Soluble
2 V H -1.2586 Soluble
3 Q H -1.9032 Soluble
4 L H 0.0000 Buried
5 V H -0.8920 Soluble
6 E H 0.0000 Buried
7 S H -0.7472 Soluble
8 G H -0.5778 Soluble
9 A H -0.1062 Soluble
11 E H -0.2702 Soluble
12 V H 0.7159 Aggregation-prone
13 K H -0.9239 Soluble
14 K H -1.8227 Soluble
15 P H -2.1434 Soluble
16 G H -1.5780 Soluble
17 S H -1.1979 Soluble
18 S H -1.4446 Soluble
19 V H 0.0000 Buried
20 K H -2.1901 Soluble
21 V H 0.0000 Buried
22 S H -0.9019 Soluble
23 C H 0.0000 Buried
24 K H -2.0456 Soluble
25 A H -1.3100 Soluble
26 S H -1.2115 Soluble
27 G H -1.0744 Soluble
28 G H -0.1283 Soluble
29 P H 0.1219 Aggregation-prone
30 F H 1.4504 Aggregation-prone
35 R H 0.0875 Aggregation-prone
36 S H 0.3559 Aggregation-prone
37 Y H 0.4326 Aggregation-prone
38 A H 0.0000 Buried
39 I H 0.0000 Buried
40 S H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H 0.0000 Buried
44 Q H -0.6166 Soluble
45 A H -0.9951 Soluble
46 P H -0.8574 Soluble
47 G H -1.2153 Soluble
48 Q H -1.7311 Soluble
49 G H -1.1330 Soluble
50 P H 0.0000 Buried
51 E H -0.8079 Soluble
52 W H 0.0000 Buried
53 M H 0.0000 Buried
54 G H 0.0000 Buried
55 G H 0.0000 Buried
56 I H 0.0000 Buried
57 I H 0.0000 Buried
58 P H 1.4163 Aggregation-prone
59 I H 2.9011 Aggregation-prone
62 F H 2.7970 Aggregation-prone
63 G H 0.9982 Aggregation-prone
64 T H 0.3553 Aggregation-prone
65 T H -0.3737 Soluble
66 K H -0.8537 Soluble
67 Y H -0.8606 Soluble
68 A H 0.0000 Buried
69 P H -1.6018 Soluble
70 K H -2.1629 Soluble
71 F H 0.0000 Buried
72 Q H -1.9749 Soluble
74 G H -1.4011 Soluble
75 R H -1.3138 Soluble
76 V H 0.0000 Buried
77 T H -0.9113 Soluble
78 I H 0.0000 Buried
79 T H -0.4866 Soluble
80 A H -0.4920 Soluble
81 D H -0.6424 Soluble
82 D H -0.2664 Soluble
83 F H 1.4305 Aggregation-prone
84 A H 0.1994 Aggregation-prone
85 G H -0.4526 Soluble
86 T H -0.6724 Soluble
87 V H 0.0000 Buried
88 Y H -0.7631 Soluble
89 M H 0.0000 Buried
90 E H -1.7650 Soluble
91 L H 0.0000 Buried
92 S H -1.2460 Soluble
93 S H -1.2205 Soluble
94 L H 0.0000 Buried
95 R H -3.1083 Soluble
96 S H -2.3907 Soluble
97 E H -2.5830 Soluble
98 D H 0.0000 Buried
99 T H -0.9125 Soluble
100 A H 0.0000 Buried
101 M H 0.0307 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 K H -0.1509 Soluble
107 H H 0.0000 Buried
108 M H 0.1635 Aggregation-prone
109 G H -0.0833 Soluble
110 Y H 0.6199 Aggregation-prone
111 Q H -0.8544 Soluble
112A V H 0.0000 Buried
112 R H -0.3301 Soluble
113 E H 0.0000 Buried
114 T H 0.0000 Buried
115 M H 0.0000 Buried
116 D H -0.4739 Soluble
117 V H -0.6102 Soluble
118 W H -0.5920 Soluble
119 G H 0.0000 Buried
120 K H -1.7149 Soluble
121 G H 0.0000 Buried
122 T H 0.0000 Buried
123 T H 0.1109 Aggregation-prone
124 V H 0.0000 Buried
125 T H -0.3696 Soluble
126 V H 0.0000 Buried
127 S H -1.0261 Soluble
128 S H -1.0693 Soluble
129 A H -0.5286 Soluble
130 S H -0.6401 Soluble
131 T H -0.9222 Soluble
132 K H -1.6107 Soluble
133 G H -1.3849 Soluble
134 P H -1.0131 Soluble
135 S H -1.0668 Soluble
136 K H -0.6577 Soluble
137 D H -0.7389 Soluble
138 Y H 0.0000 Buried
139 F H 0.0000 Buried
140 P H -1.0482 Soluble
141 E H -1.9450 Soluble
142 P H -1.1607 Soluble
143 P H -0.3806 Soluble
144 A H 0.3301 Aggregation-prone
145 V H 0.0000 Buried
146 L H 1.5318 Aggregation-prone
147 Q H 0.6925 Aggregation-prone
148 S H 0.1577 Aggregation-prone
149 S H -0.0630 Soluble
150 G H 0.1666 Aggregation-prone
151 L H -0.0907 Soluble
152 Y H 0.5276 Aggregation-prone
153 S H 0.0000 Buried
154 L H 0.8958 Aggregation-prone
155 S H 0.6030 Aggregation-prone
3 V L 1.4469 Aggregation-prone
4 L L 0.0000 Buried
5 T L 0.0463 Aggregation-prone
6 Q L 0.0000 Buried
7 P L -0.5281 Soluble
8 P L -0.7819 Soluble
9 S L -0.7919 Soluble
11 V L -0.2546 Soluble
12 S L -0.1605 Soluble
13 A L -0.3826 Soluble
14 A L -0.2822 Soluble
15 P L -1.0212 Soluble
16 G L -1.7652 Soluble
17 Q L -2.3561 Soluble
18 K L -2.3909 Soluble
19 V L -0.9992 Soluble
20 T L -0.3805 Soluble
21 I L 0.0000 Buried
22 S L -0.3467 Soluble
23 C L 0.0000 Buried
24 S L -0.2267 Soluble
25 G L 0.0253 Aggregation-prone
26 S L -0.4264 Soluble
27 S L -1.1734 Soluble
28 S L -1.3360 Soluble
29 N L 0.0000 Buried
30 I L 0.0000 Buried
35 G L -1.0945 Soluble
36 N L -1.5870 Soluble
37 D L -0.7344 Soluble
38 Y L 0.2309 Aggregation-prone
39 V L 0.0000 Buried
40 S L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L 0.0000 Buried
45 L L -0.2131 Soluble
46 P L -0.3897 Soluble
47 G L -0.6996 Soluble
48 T L -0.7354 Soluble
49 A L -0.7333 Soluble
50 P L 0.0000 Buried
51 K L -1.1237 Soluble
52 L L 0.0000 Buried
53 L L 0.0000 Buried
54 I L 0.0000 Buried
55 Y L -1.2860 Soluble
56 D L -1.5279 Soluble
57 N L -1.6112 Soluble
65 N L -2.6265 Soluble
66 K L -2.9549 Soluble
67 R L -2.3435 Soluble
68 P L -1.0154 Soluble
69 S L -0.7628 Soluble
70 G L -0.8161 Soluble
71 I L -1.0600 Soluble
72 P L -1.2586 Soluble
74 D L -2.1626 Soluble
75 R L -1.5222 Soluble
76 F L 0.0000 Buried
77 S L -1.3671 Soluble
78 G L -1.3828 Soluble
79 S L -1.3969 Soluble
80 K L -1.1742 Soluble
83 S L -0.8535 Soluble
84 G L -1.0492 Soluble
85 T L -0.9050 Soluble
86 S L -0.6822 Soluble
87 A L 0.0000 Buried
88 T L -0.5821 Soluble
89 L L 0.0000 Buried
90 G L 0.0000 Buried
91 I L 0.0000 Buried
92 T L -1.8430 Soluble
93 G L -1.7783 Soluble
94 L L 0.0000 Buried
95 Q L -1.5702 Soluble
96 T L -0.8530 Soluble
97 G L -1.0345 Soluble
98 D L 0.0000 Buried
99 E L -1.2737 Soluble
100 A L 0.0000 Buried
101 N L -0.9436 Soluble
102 Y L 0.0000 Buried
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 A L 0.0000 Buried
106 T L 0.0000 Buried
107 W L -0.5281 Soluble
108 D L 0.0000 Buried
109 R L -2.7554 Soluble
110 R L -2.2333 Soluble
112 P L -1.4297 Soluble
113 T L -1.3630 Soluble
114 A L -1.2587 Soluble
115 Y L -0.8840 Soluble
116 V L 0.0000 Buried
117 V L 0.0000 Buried
118 F L 0.0000 Buried
119 G L 0.0000 Buried
120 G L -0.5573 Soluble
121 G L -0.9813 Soluble
122 T L 0.0000 Buried
123 K L -1.5961 Soluble
124 L L 0.0000 Buried
125 T L -0.2407 Soluble
126 V L 0.0989 Aggregation-prone
127 L L 1.3551 Aggregation-prone
128 E L -2.7442 Soluble
129 E L -3.0079 Soluble
130 L L -1.4179 Soluble
131 Q L -2.3067 Soluble
132 A L -2.0204 Soluble
133 N L -2.2797 Soluble
134 K L -2.6825 Soluble
135 A L -1.0819 Soluble
136 T L 0.6045 Aggregation-prone
137 L L 2.6599 Aggregation-prone
138 V L 3.0301 Aggregation-prone
139 C L 2.8222 Aggregation-prone
140 L L 3.0248 Aggregation-prone
141 I L 2.3088 Aggregation-prone
142 S L 0.5804 Aggregation-prone
143 D L -0.8309 Soluble
144 F L 1.7113 Aggregation-prone
145 Y L 1.6181 Aggregation-prone
146 G L 0.4843 Aggregation-prone
147 V L 1.7701 Aggregation-prone
148 E L 0.8908 Aggregation-prone
149 T L 0.4945 Aggregation-prone
150 T L 0.0000 Buried
151 T L -0.4065 Soluble
152 P L -0.2411 Soluble
153 S L -1.3410 Soluble
154 K L -2.7867 Soluble
155 Q L -2.9390 Soluble
156 S L -2.0628 Soluble
157 N L -2.9223 Soluble
158 N L -2.6944 Soluble
159 K L -1.7235 Soluble
160 Y L -0.3980 Soluble
161 A L -0.1771 Soluble
162 A L 0.4108 Aggregation-prone
163 S L 0.0000 Buried
164 S L 1.7724 Aggregation-prone
165 Y L 0.0000 Buried
166 L L 1.9706 Aggregation-prone
167 S L 0.6624 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.3053 5.8088 CSV PDB
4.5 -0.3404 5.8088 CSV PDB
5.0 -0.3812 5.8088 CSV PDB
5.5 -0.4187 5.8088 CSV PDB
6.0 -0.4423 5.8088 CSV PDB
6.5 -0.4428 5.8088 CSV PDB
7.0 -0.4198 5.8088 CSV PDB
7.5 -0.3812 5.8088 CSV PDB
8.0 -0.3345 5.8088 CSV PDB
8.5 -0.2821 5.8087 CSV PDB
9.0 -0.2245 5.8085 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH