Diridavumab / 8diu

A4DAB087_8diu_G_C | Source PDB: 8diu | Chains: G, C | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5247
Max Score
2.9929
Min Score
-3.0646
Total Score
-119.64
Score CDR
-0.2843
Score non-CDR
-0.5975

Calculation Parameters

Chain Sequence(s) VQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRRPTAYVVFGGGTKLTVL input.pdb
Selected Chain(s) G (Heavy), C (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.0646
Maximum Score 2.9929
Average Score -0.5247
Total Score -119.6355

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V G 1.0857 Aggregation-prone
3 Q G -0.4381 Soluble
4 L G 0.0000 Buried
5 V G 0.2957 Aggregation-prone
6 E G 0.0000 Buried
7 S G -0.4560 Soluble
8 G G -0.4740 Soluble
9 A G -0.0602 Soluble
11 E G -0.0898 Soluble
12 V G 0.8941 Aggregation-prone
13 K G -0.7870 Soluble
14 K G -2.2112 Soluble
15 P G -2.3165 Soluble
16 G G -1.7178 Soluble
17 S G -1.3243 Soluble
18 S G -1.4701 Soluble
19 V G 0.0000 Buried
20 K G -2.1417 Soluble
21 V G 0.0000 Buried
22 S G -0.5729 Soluble
23 C G 0.0000 Buried
24 K G -1.1145 Soluble
25 A G -0.3987 Soluble
26 S G -0.5119 Soluble
27 G G -0.5012 Soluble
28 G G -0.1848 Soluble
29 P G 0.1821 Aggregation-prone
30 F G 1.5782 Aggregation-prone
35 R G 0.5990 Aggregation-prone
36 S G 0.7906 Aggregation-prone
37 Y G 0.8891 Aggregation-prone
38 A G 0.0000 Buried
39 I G 0.0000 Buried
40 S G 0.0000 Buried
41 W G 0.0000 Buried
42 V G 0.0000 Buried
43 R G 0.0000 Buried
44 Q G 0.0000 Buried
45 A G -0.8020 Soluble
46 P G -0.8140 Soluble
47 G G -1.1950 Soluble
48 Q G -1.6967 Soluble
49 G G -1.1213 Soluble
50 P G 0.0000 Buried
51 E G -0.6489 Soluble
52 W G 0.0000 Buried
53 M G 0.0000 Buried
54 G G 0.0000 Buried
55 G G 0.0000 Buried
56 I G 0.0000 Buried
57 I G 0.0000 Buried
58 P G 0.0000 Buried
59 I G 2.9929 Aggregation-prone
62 F G 2.8098 Aggregation-prone
63 G G 1.1110 Aggregation-prone
64 T G 0.4675 Aggregation-prone
65 T G -0.1699 Soluble
66 K G -0.6293 Soluble
67 Y G -0.7740 Soluble
68 A G 0.0000 Buried
69 P G -1.5558 Soluble
70 K G -2.2812 Soluble
71 F G 0.0000 Buried
72 Q G -2.1867 Soluble
74 G G -1.5393 Soluble
75 R G -1.4334 Soluble
76 V G 0.0000 Buried
77 T G -0.9223 Soluble
78 I G 0.0000 Buried
79 T G -0.6586 Soluble
80 A G -0.9551 Soluble
81 D G -1.5457 Soluble
82 D G -0.6116 Soluble
83 F G 1.1228 Aggregation-prone
84 A G 0.0347 Aggregation-prone
85 G G -0.6319 Soluble
86 T G 0.0000 Buried
87 V G 0.0000 Buried
88 Y G -0.7285 Soluble
89 M G 0.0000 Buried
90 E G -1.7197 Soluble
91 L G 0.0000 Buried
92 S G -1.2534 Soluble
93 S G -1.2991 Soluble
94 L G 0.0000 Buried
95 R G -2.8907 Soluble
96 S G -2.1998 Soluble
97 E G -1.9636 Soluble
98 D G 0.0000 Buried
99 T G -0.6328 Soluble
100 A G 0.0000 Buried
101 M G 0.0509 Aggregation-prone
102 Y G 0.0000 Buried
103 Y G 0.0000 Buried
104 C G 0.0000 Buried
105 A G 0.0000 Buried
106 K G 0.1674 Aggregation-prone
107 H G 0.0000 Buried
108 M G 0.3986 Aggregation-prone
109 G G 0.3208 Aggregation-prone
110 Y G 1.2563 Aggregation-prone
111 Q G -0.1791 Soluble
112A V G 0.0000 Buried
112 R G -1.1624 Soluble
113 E G 0.0000 Buried
114 T G -0.4622 Soluble
115 M G 0.0000 Buried
116 D G -0.5859 Soluble
117 V G 0.0288 Aggregation-prone
118 W G -0.3602 Soluble
119 G G -0.7632 Soluble
120 K G -1.5729 Soluble
121 G G -0.6949 Soluble
122 T G 0.0000 Buried
123 T G 0.1352 Aggregation-prone
124 V G 0.0000 Buried
125 T G -0.1041 Soluble
126 V G 0.0000 Buried
127 S G -1.0047 Soluble
3 V C 1.5539 Aggregation-prone
4 L C 0.0000 Buried
5 T C 0.0124 Aggregation-prone
6 Q C 0.0000 Buried
7 P C -0.5765 Soluble
8 P C -0.8754 Soluble
9 S C -0.9379 Soluble
11 V C -0.3598 Soluble
12 S C -0.2046 Soluble
13 A C -0.2280 Soluble
14 A C -0.4791 Soluble
15 P C -1.1206 Soluble
16 G C -1.7787 Soluble
17 Q C -2.2726 Soluble
18 K C -2.3364 Soluble
19 V C -0.9402 Soluble
20 T C -0.3411 Soluble
21 I C 0.0000 Buried
22 S C -0.2953 Soluble
23 C C 0.0000 Buried
24 S C -0.2453 Soluble
25 G C -0.0184 Soluble
26 S C -0.4106 Soluble
27 S C -0.9387 Soluble
28 S C -1.3372 Soluble
29 N C 0.0000 Buried
30 I C 0.0000 Buried
35 G C -1.1720 Soluble
36 N C -1.7279 Soluble
37 D C -1.0002 Soluble
38 Y C -0.1887 Soluble
39 V C 0.0000 Buried
40 S C 0.0000 Buried
41 W C 0.0000 Buried
42 Y C 0.0000 Buried
43 Q C 0.0000 Buried
44 Q C -0.8786 Soluble
45 L C -0.4560 Soluble
46 P C -0.4891 Soluble
47 G C -0.7649 Soluble
48 T C -0.8358 Soluble
49 A C -0.8487 Soluble
50 P C 0.0000 Buried
51 K C -1.4091 Soluble
52 L C 0.0000 Buried
53 L C 0.0000 Buried
54 I C 0.0000 Buried
55 Y C -1.3782 Soluble
56 D C -1.8830 Soluble
57 N C -1.7132 Soluble
65 N C -2.6222 Soluble
66 K C -2.8405 Soluble
67 R C -2.1918 Soluble
68 P C -0.9287 Soluble
69 S C -0.5463 Soluble
70 G C -0.7680 Soluble
71 I C -0.9961 Soluble
72 P C -1.2216 Soluble
74 D C -2.1494 Soluble
75 R C -1.5474 Soluble
76 F C 0.0000 Buried
77 S C -1.4050 Soluble
78 G C -1.3933 Soluble
79 S C -1.3927 Soluble
80 K C -1.0769 Soluble
83 S C -0.7758 Soluble
84 G C -0.9904 Soluble
85 T C -0.9080 Soluble
86 S C -0.6572 Soluble
87 A C 0.0000 Buried
88 T C -0.5520 Soluble
89 L C 0.0000 Buried
90 G C 0.0000 Buried
91 I C 0.0000 Buried
92 T C -1.8429 Soluble
93 G C -1.7812 Soluble
94 L C 0.0000 Buried
95 Q C -1.7639 Soluble
96 T C -0.8545 Soluble
97 G C -1.0192 Soluble
98 D C 0.0000 Buried
99 E C -1.2211 Soluble
100 A C 0.0000 Buried
101 N C -1.1355 Soluble
102 Y C 0.0000 Buried
103 Y C 0.0000 Buried
104 C C 0.0000 Buried
105 A C 0.0000 Buried
106 T C 0.0000 Buried
107 W C 0.0000 Buried
108 D C -1.5825 Soluble
109 R C -3.0646 Soluble
110 R C -2.9024 Soluble
112 P C -1.6278 Soluble
113 T C -1.2701 Soluble
114 A C -1.6341 Soluble
115 Y C -0.7482 Soluble
116 V C 0.0000 Buried
117 V C 0.0000 Buried
118 F C 0.0000 Buried
119 G C 0.0000 Buried
120 G C -0.4994 Soluble
121 G C -1.0636 Soluble
122 T C 0.0000 Buried
123 K C -1.9867 Soluble
124 L C 0.0000 Buried
125 T C -0.2710 Soluble
126 V C 0.3061 Aggregation-prone
127 L C 1.4753 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.4175 5.8836 CSV PDB
4.5 -0.4433 5.7758 CSV PDB
5.0 -0.4722 5.7758 CSV PDB
5.5 -0.498 5.7758 CSV PDB
6.0 -0.5128 5.7758 CSV PDB
6.5 -0.5102 5.7758 CSV PDB
7.0 -0.4906 5.7757 CSV PDB
7.5 -0.4604 5.7757 CSV PDB
8.0 -0.4249 5.7757 CSV PDB
8.5 -0.3851 5.7756 CSV PDB
9.0 -0.3406 5.7753 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH