Tixagevimab / 7tcc

A4DAB270_7tcc_O_P | Source PDB: 7tcc | Chains: O, P | Done
95.26
Yes
10 Å
Yes
Avg A4D Score
-0.6727
Max Score
1.4014
Min Score
-3.4921
Total Score
-154.72
Score CDR
-0.3715
Score non-CDR
-0.7585

Calculation Parameters

Chain Sequence(s) MQLVQSGPEVKKPGTSVKVSCKASGFTFTSSAVQWVRQARGQRLEWIGWIVVGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAAPYCSGGSCFDGFDIWGQGTMVTVSSEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGFPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGNSPWTFGQGTKVEIR input.pdb
Selected Chain(s) O (Heavy), P (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.4921
Maximum Score 1.4014
Average Score -0.6727
Total Score -154.722

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 M O 0.4350 Aggregation-prone
3 Q O -0.7646 Soluble
4 L O 0.0000 Buried
5 V O -0.4803 Soluble
6 Q O 0.0000 Buried
7 S O -0.7427 Soluble
8 G O -0.4364 Soluble
9 P O -0.1606 Soluble
11 E O -0.2163 Soluble
12 V O 0.8877 Aggregation-prone
13 K O -0.8932 Soluble
14 K O -1.9047 Soluble
15 P O -1.8013 Soluble
16 G O -1.2466 Soluble
17 T O -0.4569 Soluble
18 S O -0.5421 Soluble
19 V O -0.6473 Soluble
20 K O -1.5336 Soluble
21 V O 0.0000 Buried
22 S O -0.4731 Soluble
23 C O 0.0000 Buried
24 K O -1.1980 Soluble
25 A O 0.0000 Buried
26 S O -0.5174 Soluble
27 G O -0.2248 Soluble
28 F O 0.0534 Aggregation-prone
29 T O -0.1724 Soluble
30 F O 0.0515 Aggregation-prone
35 T O -0.1355 Soluble
36 S O -0.3930 Soluble
37 S O -0.1459 Soluble
38 A O -0.0147 Soluble
39 V O 0.0000 Buried
40 Q O 0.0000 Buried
41 W O 0.0000 Buried
42 V O 0.0000 Buried
43 R O -0.9372 Soluble
44 Q O 0.0000 Buried
45 A O 0.0000 Buried
46 R O -2.6939 Soluble
47 G O -2.1538 Soluble
48 Q O -2.6527 Soluble
49 R O -2.2248 Soluble
50 L O 0.0000 Buried
51 E O -1.1009 Soluble
52 W O 0.0000 Buried
53 I O 0.0000 Buried
54 G O 0.0000 Buried
55 W O 0.0016 Aggregation-prone
56 I O 0.0000 Buried
57 V O -0.5669 Soluble
58 V O 0.0000 Buried
59 G O -1.0012 Soluble
62 S O -1.2695 Soluble
63 G O -1.5677 Soluble
64 N O -1.6851 Soluble
65 T O -0.9850 Soluble
66 N O -1.3021 Soluble
67 Y O -1.3311 Soluble
68 A O 0.0000 Buried
69 Q O -2.6034 Soluble
70 K O -3.0411 Soluble
71 F O -2.4482 Soluble
72 Q O -3.2398 Soluble
74 E O -3.4921 Soluble
75 R O -2.7245 Soluble
76 V O -1.0645 Soluble
77 T O -0.6154 Soluble
78 I O -0.1255 Soluble
79 T O -0.7009 Soluble
80 R O -1.7651 Soluble
81 D O -0.9934 Soluble
82 M O 0.1068 Aggregation-prone
83 S O -0.2733 Soluble
84 T O -0.2600 Soluble
85 S O -0.5005 Soluble
86 T O 0.0000 Buried
87 A O 0.0000 Buried
88 Y O -0.5499 Soluble
89 M O 0.0000 Buried
90 E O -0.4431 Soluble
91 L O 0.0170 Aggregation-prone
92 S O 0.0000 Buried
93 S O -0.8215 Soluble
94 L O -0.9785 Soluble
95 R O -2.3992 Soluble
96 S O -2.3636 Soluble
97 E O -2.5290 Soluble
98 D O -1.5778 Soluble
99 T O -0.9126 Soluble
100 A O 0.0000 Buried
101 V O 0.0000 Buried
102 Y O 0.0000 Buried
103 Y O 0.0000 Buried
104 C O 0.0000 Buried
105 A O 0.0000 Buried
106 A O 0.0000 Buried
107 P O 0.0000 Buried
108 Y O 0.3500 Aggregation-prone
109 C O 0.0000 Buried
110 S O -0.4153 Soluble
111 G O -0.7950 Soluble
111A G O -0.7256 Soluble
112B S O -0.4660 Soluble
112A C O 0.0076 Aggregation-prone
112 F O -0.1735 Soluble
113 D O -0.9048 Soluble
114 G O 0.0000 Buried
115 F O 0.0000 Buried
116 D O -0.5811 Soluble
117 I O -0.1580 Soluble
118 W O -0.5870 Soluble
119 G O 0.0000 Buried
120 Q O -1.4822 Soluble
121 G O -0.8928 Soluble
122 T O 0.0000 Buried
123 M O 0.3474 Aggregation-prone
124 V O 0.3645 Aggregation-prone
125 T O -0.2082 Soluble
126 V O 0.0000 Buried
127 S O -0.8914 Soluble
128 S O -0.6785 Soluble
1 E P -1.1659 Soluble
2 I P 0.6154 Aggregation-prone
3 V P 1.4014 Aggregation-prone
4 L P 0.0000 Buried
5 T P 0.1395 Aggregation-prone
6 Q P 0.0000 Buried
7 S P -0.4091 Soluble
8 P P -0.3204 Soluble
9 G P -0.6174 Soluble
10 T P -0.4393 Soluble
11 L P 0.3559 Aggregation-prone
12 S P -0.4780 Soluble
13 L P -0.5625 Soluble
14 S P -0.9413 Soluble
15 P P -1.4738 Soluble
16 G P -2.0699 Soluble
17 E P -2.0074 Soluble
18 R P -2.4508 Soluble
19 A P -1.3368 Soluble
20 T P -0.6449 Soluble
21 L P 0.0000 Buried
22 S P -0.5003 Soluble
23 C P 0.0000 Buried
24 R P -0.6289 Soluble
25 A P 0.0000 Buried
26 S P -0.4939 Soluble
27 Q P -1.4046 Soluble
28 S P -0.9255 Soluble
29 V P -0.5391 Soluble
30 S P -0.3719 Soluble
36 S P -0.2184 Soluble
37 S P -0.0162 Soluble
38 Y P 0.4210 Aggregation-prone
39 L P 0.0000 Buried
40 A P 0.0000 Buried
41 W P 0.0000 Buried
42 Y P 0.0000 Buried
43 Q P -0.8704 Soluble
44 Q P 0.0000 Buried
45 K P -1.2915 Soluble
46 P P -1.2696 Soluble
47 G P -1.7074 Soluble
48 Q P -2.1192 Soluble
49 A P -1.5048 Soluble
50 P P 0.0000 Buried
51 R P -1.9693 Soluble
52 L P 0.0000 Buried
53 L P 0.0000 Buried
54 I P 0.0000 Buried
55 Y P -0.0639 Soluble
56 G P 0.0000 Buried
57 A P 0.0000 Buried
65 S P -0.3572 Soluble
66 S P -0.4311 Soluble
67 R P -0.6723 Soluble
68 A P -0.2438 Soluble
69 T P -0.3131 Soluble
70 G P -0.5841 Soluble
71 F P -0.3008 Soluble
72 P P -1.4220 Soluble
74 D P -2.6887 Soluble
75 R P -2.9235 Soluble
76 F P -1.6102 Soluble
77 S P -1.0723 Soluble
78 G P -0.4120 Soluble
79 S P -0.6634 Soluble
80 G P -0.9200 Soluble
83 S P -1.0124 Soluble
84 G P -1.1426 Soluble
85 T P -1.2678 Soluble
86 D P -1.5138 Soluble
87 F P 0.0000 Buried
88 T P -0.6112 Soluble
89 L P 0.0000 Buried
90 T P -1.0217 Soluble
91 I P 0.0000 Buried
92 S P -2.2722 Soluble
93 R P -3.0345 Soluble
94 L P -2.4493 Soluble
95 E P -2.3011 Soluble
96 P P -1.8852 Soluble
97 E P -2.1953 Soluble
98 D P 0.0000 Buried
99 F P -1.0010 Soluble
100 A P 0.0000 Buried
101 V P -0.4065 Soluble
102 Y P -0.4551 Soluble
103 Y P 0.0000 Buried
104 C P 0.0000 Buried
105 Q P 0.0000 Buried
106 Q P 0.0000 Buried
107 Y P 0.0000 Buried
108 G P -0.4358 Soluble
109 N P -0.9474 Soluble
114 S P -0.9009 Soluble
115 P P -0.8123 Soluble
116 W P -0.3190 Soluble
117 T P -0.2000 Soluble
118 F P 0.0000 Buried
119 G P 0.0000 Buried
120 Q P -1.3347 Soluble
121 G P -1.0466 Soluble
122 T P 0.0000 Buried
123 K P -1.1985 Soluble
124 V P 0.0000 Buried
125 E P -1.4562 Soluble
126 I P -0.2348 Soluble
127 R P -1.4393 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.7346 2.0484 CSV PDB
4.5 -0.7762 2.0086 CSV PDB
5.0 -0.8263 1.9506 CSV PDB
5.5 -0.8758 1.8851 CSV PDB
6.0 -0.9156 1.8239 CSV PDB
6.5 -0.9388 1.7789 CSV PDB
7.0 -0.9438 1.7573 CSV PDB
7.5 -0.936 1.7553 CSV PDB
8.0 -0.9213 1.7634 CSV PDB
8.5 -0.9019 1.7754 CSV PDB
9.0 -0.8782 1.7886 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH