Umizortamig1 / 3g5x

Calculation Parameters

Chain Sequence(s)	`DVQLQESGPSLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYISYSGNTRYNPSLKSRISITRDTSKNQFFLQLNSVTIEDTATYYCVTAGRGFPYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEPSDILMTQSPSSMSVSLGDTVSITCHSSQDINSNIGWLQQKPGKSFKGLIYHGTNLDDEVPSRFSGSGSGADYSLTISSLESEDFADYYCVQYAQFPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC` input.pdb
Selected Chain(s)	D (Heavy), C (Light)
Distance of Aggregation	10 Å
FoldX Energy Minimization	Yes
pH Calculations	Yes
Downloads	Download all data (.tar.gz)

Aggrescan4D Profile

Chain: Show buried residues (score = 0)

Aggregation-prone (score > 0)

Soluble (score < 0)

Buried (score = 0)

Per-Residue A4D Scores

Download CSV

Minimum Score -3.8275

Maximum Score 1.1342

Average Score -0.6899

Total Score -296.6739

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Classification:

Index	Residue	Chain	A4D Score	Classification
1	D	D	-2.3493	Soluble
2	V	D	-1.1532	Soluble
3	Q	D	-1.6824	Soluble
4	L	D	0.0000	Buried
5	Q	D	-1.5000	Soluble
6	E	D	0.0000	Buried
7	S	D	-0.6480	Soluble
8	G	D	-0.4037	Soluble
9	P	D	-0.2400	Soluble
11	S	D	0.1806	Aggregation-prone
12	L	D	0.4435	Aggregation-prone
13	V	D	0.0000	Buried
14	K	D	-0.8307	Soluble
15	P	D	-0.8853	Soluble
16	S	D	-1.1061	Soluble
17	Q	D	-1.7681	Soluble
18	S	D	-1.3307	Soluble
19	L	D	0.0000	Buried
20	S	D	-0.7532	Soluble
21	L	D	0.0000	Buried
22	T	D	-0.4183	Soluble
23	C	D	0.0000	Buried
24	T	D	-0.9925	Soluble
25	V	D	0.0000	Buried
26	T	D	-1.0786	Soluble
27	G	D	-0.8753	Soluble
28	Y	D	-0.3625	Soluble
29	S	D	-0.3238	Soluble
30	I	D	0.0000	Buried
31	T	D	-0.2065	Soluble
35	S	D	-0.3254	Soluble
36	D	D	-0.5682	Soluble
37	F	D	-0.2401	Soluble
38	A	D	-0.2100	Soluble
39	W	D	0.0000	Buried
40	N	D	0.0000	Buried
41	W	D	0.0000	Buried
42	I	D	0.0000	Buried
43	R	D	0.0000	Buried
44	Q	D	0.0000	Buried
45	F	D	-0.9023	Soluble
46	P	D	-0.9629	Soluble
47	G	D	-1.2521	Soluble
48	N	D	-1.6397	Soluble
49	K	D	-2.1651	Soluble
50	L	D	0.0000	Buried
51	E	D	-0.5940	Soluble
52	W	D	0.0000	Buried
53	M	D	0.0000	Buried
54	G	D	0.0000	Buried
55	Y	D	-0.3641	Soluble
56	I	D	0.0000	Buried
57	S	D	-0.4756	Soluble
58	Y	D	0.0681	Aggregation-prone
59	S	D	-0.4368	Soluble
63	G	D	-0.7473	Soluble
64	N	D	-1.5755	Soluble
65	T	D	-1.2414	Soluble
66	R	D	-1.7185	Soluble
67	Y	D	-1.0509	Soluble
68	N	D	0.0000	Buried
69	P	D	-1.2842	Soluble
70	S	D	-0.8560	Soluble
71	L	D	0.0000	Buried
72	K	D	-2.1070	Soluble
74	S	D	-1.2531	Soluble
75	R	D	-1.2406	Soluble
76	I	D	0.0000	Buried
77	S	D	-0.8123	Soluble
78	I	D	0.0000	Buried
79	T	D	-0.5644	Soluble
80	R	D	-0.8977	Soluble
81	D	D	-1.3859	Soluble
82	T	D	-1.1094	Soluble
83	S	D	-1.3968	Soluble
84	K	D	-2.2248	Soluble
85	N	D	-1.4949	Soluble
86	Q	D	-1.2828	Soluble
87	F	D	0.0000	Buried
88	F	D	-0.1018	Soluble
89	L	D	0.0000	Buried
90	Q	D	-0.8200	Soluble
91	L	D	0.0000	Buried
92	N	D	-1.2156	Soluble
93	S	D	-1.1058	Soluble
94	V	D	0.0000	Buried
95	T	D	-0.6299	Soluble
96	I	D	-0.0479	Soluble
97	E	D	-1.3324	Soluble
98	D	D	0.0000	Buried
99	T	D	-0.0185	Soluble
100	A	D	0.0000	Buried
101	T	D	0.2210	Aggregation-prone
102	Y	D	0.0000	Buried
103	Y	D	0.0000	Buried
104	C	D	0.0000	Buried
105	V	D	0.0000	Buried
106	T	D	0.0000	Buried
107	A	D	-0.4311	Soluble
108	G	D	-1.0574	Soluble
109	R	D	-2.2865	Soluble
114	G	D	0.0000	Buried
115	F	D	0.0000	Buried
116	P	D	0.0000	Buried
117	Y	D	-0.4118	Soluble
118	W	D	0.0000	Buried
119	G	D	0.0000	Buried
120	Q	D	-1.7117	Soluble
121	G	D	-0.8395	Soluble
122	T	D	-0.1161	Soluble
123	L	D	0.7814	Aggregation-prone
124	V	D	0.0000	Buried
125	T	D	0.1419	Aggregation-prone
126	V	D	0.0000	Buried
127	S	D	0.0000	Buried
128	A	D	-0.4267	Soluble
129	A	D	-0.9645	Soluble
130	K	D	-1.7468	Soluble
131	T	D	-1.0332	Soluble
132	T	D	-0.6992	Soluble
133	P	D	-0.4412	Soluble
134	P	D	0.0000	Buried
135	S	D	-0.3608	Soluble
136	V	D	0.0000	Buried
137	Y	D	0.0000	Buried
138	P	D	-1.1491	Soluble
139	L	D	0.0000	Buried
140	A	D	-0.5141	Soluble
141	P	D	-0.6562	Soluble
142	G	D	-0.8017	Soluble
143	C	D	-0.7097	Soluble
144	G	D	-1.4284	Soluble
145	D	D	-1.9606	Soluble
146	T	D	-1.0040	Soluble
147	T	D	-0.8464	Soluble
148	G	D	-0.8750	Soluble
149	S	D	-0.6684	Soluble
150	S	D	-0.6222	Soluble
151	V	D	0.0000	Buried
152	T	D	0.0000	Buried
153	L	D	0.0000	Buried
154	G	D	0.0000	Buried
155	C	D	0.0000	Buried
156	L	D	0.0000	Buried
157	V	D	0.0000	Buried
158	K	D	-0.0972	Soluble
159	G	D	-0.1264	Soluble
160	Y	D	0.0000	Buried
161	F	D	0.0000	Buried
162	P	D	-0.8161	Soluble
163	E	D	-0.9920	Soluble
164	S	D	-0.6960	Soluble
165	V	D	-0.2750	Soluble
166	T	D	-0.1939	Soluble
167	V	D	0.0000	Buried
168	T	D	-0.2571	Soluble
169	W	D	0.0000	Buried
170	N	D	-1.0371	Soluble
171	S	D	-0.5021	Soluble
172	G	D	-0.3871	Soluble
173	S	D	0.0701	Aggregation-prone
174	L	D	1.1342	Aggregation-prone
175	S	D	0.0000	Buried
176	S	D	0.1822	Aggregation-prone
177	S	D	0.1993	Aggregation-prone
178	V	D	0.5391	Aggregation-prone
179	H	D	0.0000	Buried
180	T	D	0.0290	Aggregation-prone
181	F	D	0.0000	Buried
182	P	D	-0.2098	Soluble
183	A	D	0.2052	Aggregation-prone
184	L	D	0.5131	Aggregation-prone
185	L	D	0.8037	Aggregation-prone
186	Q	D	0.2190	Aggregation-prone
187	S	D	-0.1636	Soluble
188	G	D	-0.2066	Soluble
189	L	D	-0.0444	Soluble
190	Y	D	0.2104	Aggregation-prone
191	T	D	0.0000	Buried
192	M	D	0.0000	Buried
193	S	D	0.0000	Buried
194	S	D	0.0000	Buried
195	S	D	0.0000	Buried
196	V	D	0.0000	Buried
197	T	D	0.0119	Aggregation-prone
198	V	D	0.0000	Buried
199	P	D	-0.5750	Soluble
200	S	D	-0.6198	Soluble
201	S	D	-0.7892	Soluble
202	T	D	-0.9791	Soluble
203	W	D	0.0000	Buried
204	P	D	-1.4173	Soluble
205	S	D	-1.3091	Soluble
206	E	D	-2.0777	Soluble
207	T	D	-1.7764	Soluble
208	V	D	0.0000	Buried
209	T	D	-1.9338	Soluble
210	C	D	0.0000	Buried
211	S	D	-1.2120	Soluble
212	V	D	0.0000	Buried
213	A	D	-0.2874	Soluble
214	H	D	0.0000	Buried
215	P	D	-0.4877	Soluble
216	A	D	-0.3832	Soluble
217	S	D	-0.4354	Soluble
218	S	D	-0.3605	Soluble
219	T	D	-0.1424	Soluble
220	T	D	-0.3954	Soluble
221	V	D	-0.5999	Soluble
222	D	D	-2.2467	Soluble
223	K	D	-2.1360	Soluble
224	K	D	-2.8214	Soluble
225	L	D	0.0000	Buried
226	E	D	-2.4588	Soluble
227	P	D	-1.1311	Soluble
228	S	D	-0.6686	Soluble
1	D	C	-1.5218	Soluble
2	I	C	0.0000	Buried
3	L	C	0.7274	Aggregation-prone
4	M	C	0.0000	Buried
5	T	C	-0.2429	Soluble
6	Q	C	0.0000	Buried
7	S	C	-0.4662	Soluble
8	P	C	-0.4830	Soluble
9	S	C	-0.5958	Soluble
10	S	C	-0.5558	Soluble
11	M	C	-0.3544	Soluble
12	S	C	-0.7328	Soluble
13	V	C	0.0000	Buried
14	S	C	-0.5567	Soluble
15	L	C	-0.2998	Soluble
16	G	C	-0.8467	Soluble
17	D	C	-0.9720	Soluble
18	T	C	-0.5849	Soluble
19	V	C	0.0000	Buried
20	S	C	-0.3736	Soluble
21	I	C	0.0000	Buried
22	T	C	-0.7201	Soluble
23	C	C	0.0000	Buried
24	H	C	-1.4707	Soluble
25	S	C	0.0000	Buried
26	S	C	-1.1222	Soluble
27	Q	C	-2.3288	Soluble
28	D	C	-3.1325	Soluble
29	I	C	0.0000	Buried
36	N	C	-2.4628	Soluble
37	S	C	-1.7813	Soluble
38	N	C	-1.3467	Soluble
39	I	C	0.0000	Buried
40	G	C	0.0000	Buried
41	W	C	0.0000	Buried
42	L	C	0.0000	Buried
43	Q	C	0.0000	Buried
44	Q	C	-1.1695	Soluble
45	K	C	-1.8665	Soluble
46	P	C	-1.8143	Soluble
47	G	C	-1.6846	Soluble
48	K	C	-2.5396	Soluble
49	S	C	-1.6542	Soluble
50	F	C	0.0000	Buried
51	K	C	-0.9881	Soluble
52	G	C	0.0000	Buried
53	L	C	0.0000	Buried
54	I	C	0.0000	Buried
55	Y	C	0.0000	Buried
56	H	C	-1.5399	Soluble
57	G	C	0.0000	Buried
65	T	C	-0.8153	Soluble
66	N	C	-1.3883	Soluble
67	L	C	-1.0966	Soluble
68	D	C	-1.8907	Soluble
69	D	C	-3.0993	Soluble
70	E	C	-2.8832	Soluble
71	V	C	-1.4357	Soluble
72	P	C	-0.9316	Soluble
74	S	C	-0.6334	Soluble
75	R	C	-0.9363	Soluble
76	F	C	0.0000	Buried
77	S	C	-0.4736	Soluble
78	G	C	-0.5694	Soluble
79	S	C	-0.9623	Soluble
80	G	C	-1.4457	Soluble
83	S	C	-1.6983	Soluble
84	G	C	-2.2248	Soluble
85	A	C	-2.4641	Soluble
86	D	C	-2.7298	Soluble
87	Y	C	0.0000	Buried
88	S	C	-0.7896	Soluble
89	L	C	0.0000	Buried
90	T	C	-0.3667	Soluble
91	I	C	0.0000	Buried
92	S	C	-0.8675	Soluble
93	S	C	-1.0674	Soluble
94	L	C	0.0000	Buried
95	E	C	-2.4308	Soluble
96	S	C	-1.6539	Soluble
97	E	C	-2.4332	Soluble
98	D	C	0.0000	Buried
99	F	C	-0.8100	Soluble
100	A	C	0.0000	Buried
101	D	C	0.0000	Buried
102	Y	C	0.0000	Buried
103	Y	C	0.0000	Buried
104	C	C	0.0000	Buried
105	V	C	0.0000	Buried
106	Q	C	0.0000	Buried
107	Y	C	-0.2073	Soluble
108	A	C	-0.8880	Soluble
109	Q	C	-0.5423	Soluble
114	F	C	-0.2098	Soluble
115	P	C	0.0000	Buried
116	W	C	0.0000	Buried
117	T	C	0.0549	Aggregation-prone
118	F	C	0.0545	Aggregation-prone
119	G	C	0.0000	Buried
120	G	C	-1.0195	Soluble
121	G	C	0.0000	Buried
122	T	C	0.0000	Buried
123	K	C	-0.8702	Soluble
124	L	C	0.0000	Buried
125	E	C	0.0000	Buried
126	I	C	-0.2242	Soluble
127	K	C	-1.7671	Soluble
128	R	C	-1.8144	Soluble
129	A	C	-1.5217	Soluble
130	D	C	-2.4797	Soluble
131	A	C	-1.3152	Soluble
132	A	C	-0.7034	Soluble
133	P	C	0.0000	Buried
134	T	C	-0.1443	Soluble
135	V	C	0.0000	Buried
136	S	C	-0.2191	Soluble
137	I	C	0.0000	Buried
138	F	C	0.0000	Buried
139	P	C	-0.2699	Soluble
140	P	C	0.0000	Buried
141	S	C	-0.5372	Soluble
142	S	C	-0.8902	Soluble
143	E	C	-1.5945	Soluble
144	Q	C	0.0000	Buried
145	L	C	-1.1346	Soluble
146	T	C	-0.8683	Soluble
147	S	C	-0.8202	Soluble
148	G	C	-1.1870	Soluble
149	G	C	-1.0755	Soluble
150	A	C	0.0000	Buried
151	S	C	0.0000	Buried
152	V	C	0.0000	Buried
153	V	C	0.0000	Buried
154	C	C	0.0000	Buried
155	F	C	0.0000	Buried
156	L	C	0.0000	Buried
157	N	C	0.0000	Buried
158	N	C	-0.7506	Soluble
159	F	C	0.0000	Buried
160	Y	C	0.0000	Buried
161	P	C	-2.0353	Soluble
162	K	C	-2.1009	Soluble
163	D	C	-2.4966	Soluble
164	I	C	-1.6254	Soluble
165	N	C	-1.7786	Soluble
166	V	C	-0.6287	Soluble
167	K	C	-1.2191	Soluble
168	W	C	0.0000	Buried
169	K	C	-2.0916	Soluble
170	I	C	0.0000	Buried
171	D	C	-2.5049	Soluble
172	G	C	-1.8684	Soluble
173	S	C	-2.0243	Soluble
174	E	C	-3.0125	Soluble
175	R	C	-2.5008	Soluble
176	Q	C	-2.4025	Soluble
177	N	C	-2.0260	Soluble
178	G	C	-0.8282	Soluble
179	V	C	-0.4654	Soluble
180	L	C	-0.1647	Soluble
181	N	C	-0.1961	Soluble
182	S	C	0.1099	Aggregation-prone
183	W	C	0.0855	Aggregation-prone
184	T	C	-0.7525	Soluble
185	D	C	-1.9985	Soluble
186	Q	C	-1.6099	Soluble
187	D	C	-1.9233	Soluble
188	S	C	-1.7650	Soluble
189	K	C	-2.2420	Soluble
190	D	C	-1.7472	Soluble
191	S	C	-1.7070	Soluble
192	T	C	0.0000	Buried
193	Y	C	0.0000	Buried
194	S	C	0.0000	Buried
195	M	C	0.0000	Buried
196	S	C	0.0000	Buried
197	S	C	0.0000	Buried
198	T	C	0.0000	Buried
199	L	C	0.0000	Buried
200	T	C	-0.2213	Soluble
201	L	C	0.0000	Buried
202	T	C	-1.4750	Soluble
203	K	C	-2.5225	Soluble
204	D	C	-3.3665	Soluble
205	E	C	-2.6971	Soluble
206	Y	C	0.0000	Buried
207	E	C	-3.8275	Soluble
208	R	C	-3.7525	Soluble
209	H	C	-3.0507	Soluble
210	N	C	-3.1843	Soluble
211	S	C	-1.9003	Soluble
212	Y	C	0.0000	Buried
213	T	C	-0.9972	Soluble
214	C	C	0.0000	Buried
215	E	C	-0.1611	Soluble
216	A	C	0.0000	Buried
217	T	C	-0.9236	Soluble
218	H	C	0.0000	Buried
219	K	C	-2.5485	Soluble
220	T	C	-1.3447	Soluble
221	S	C	-0.7488	Soluble
222	T	C	-0.5806	Soluble
223	S	C	-0.3607	Soluble
224	P	C	-0.2474	Soluble
225	I	C	0.6101	Aggregation-prone
226	V	C	0.8394	Aggregation-prone
227	K	C	-0.2625	Soluble
228	S	C	-0.7510	Soluble
229	F	C	0.0000	Buried
230	N	C	-2.7042	Soluble
231	R	C	-2.8257	Soluble
232	N	C	-2.9638	Soluble
233	E	C	-2.4782	Soluble
234	C	C	-0.5678	Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer | colored by A4D score

Load structure to view sequence…

Downloads

Download PDB View in RCSB

Color Legend (B-factor = A4D Score)

Score > 1.5 — highly aggregation-prone

Score 0.5–1.5 — aggregation-prone

Score ≈ 0 — buried

Score −1 to −0.5 — soluble

Score < −2.5 — highly soluble

pH Structure

Load structure at specific pH condition

A4D Score Threshold

Highlight residues > threshold in the sequence panel

Threshold: 0.0

CDR Regions

Outline CDR regions in sequence panel

HCDR1

HCDR2

HCDR3

LCDR1

LCDR2

LCDR3

Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH	Avg A4D Score	Max A4D Score	Downloads
4.0	-0.5446	2.3308	CSV PDB
4.5	-0.5982	2.2453	CSV PDB
5.0	-0.6621	2.1494	CSV PDB
5.5	-0.7269	2.0508	CSV PDB
6.0	-0.7822	1.954	CSV PDB
6.5	-0.8202	1.8619	CSV PDB
7.0	-0.8395	1.7749	CSV PDB
7.5	-0.845	1.6922	CSV PDB
8.0	-0.8414	1.6155	CSV PDB
8.5	-0.8294	1.5514	CSV PDB
9.0	-0.8075	1.6412	CSV PDB