Tixagevimab / 7tb8

A4DAB270_7tb8_H_L | Source PDB: 7tb8 | Chains: H, L | Done
95.26
Yes
10 Å
Yes
Avg A4D Score
-0.6772
Max Score
1.3002
Min Score
-3.3484
Total Score
-155.07
Score CDR
-0.3635
Score non-CDR
-0.767

Calculation Parameters

Chain Sequence(s) MQLVQSGPEVKKPGTSVKVSCKASGFTFTSSAVQWVRQARGQRLEWIGWIVVGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAAPYCSGGSCFDGFDIWGQGTMVTVSSEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGFPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGNSPWTFGQGTKVEI input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.3484
Maximum Score 1.3002
Average Score -0.6772
Total Score -155.07

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 M H 0.4395 Aggregation-prone
3 Q H -0.8451 Soluble
4 L H -0.5873 Soluble
5 V H -0.3756 Soluble
6 Q H 0.0000 Buried
7 S H -0.8589 Soluble
8 G H -0.5850 Soluble
9 P H -0.2999 Soluble
11 E H -0.4116 Soluble
12 V H 0.5591 Aggregation-prone
13 K H -1.2564 Soluble
14 K H -1.9791 Soluble
15 P H -1.7148 Soluble
16 G H -1.4583 Soluble
17 T H -1.0969 Soluble
18 S H -1.1173 Soluble
19 V H 0.0000 Buried
20 K H -1.4151 Soluble
21 V H 0.0000 Buried
22 S H -0.6836 Soluble
23 C H 0.0000 Buried
24 K H -1.5256 Soluble
25 A H -0.8171 Soluble
26 S H -0.6960 Soluble
27 G H -0.2367 Soluble
28 F H 0.1886 Aggregation-prone
29 T H -0.0197 Soluble
30 F H -0.0285 Soluble
35 T H -0.1107 Soluble
36 S H -0.3629 Soluble
37 S H 0.0228 Aggregation-prone
38 A H 0.1462 Aggregation-prone
39 V H 0.0000 Buried
40 Q H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H -1.0888 Soluble
44 Q H -1.5964 Soluble
45 A H -1.8755 Soluble
46 R H -2.7782 Soluble
47 G H -2.2843 Soluble
48 Q H -3.0955 Soluble
49 R H -3.0955 Soluble
50 L H 0.0000 Buried
51 E H -1.8512 Soluble
52 W H 0.0000 Buried
53 I H 0.0000 Buried
54 G H 0.0000 Buried
55 W H -0.0550 Soluble
56 I H 0.0000 Buried
57 V H -0.4395 Soluble
58 V H 0.0000 Buried
59 G H -0.7973 Soluble
62 S H -1.0031 Soluble
63 G H -1.2459 Soluble
64 N H -1.4693 Soluble
65 T H -0.8156 Soluble
66 N H -1.0183 Soluble
67 Y H -1.1670 Soluble
68 A H -1.5085 Soluble
69 Q H -2.3847 Soluble
70 K H -2.8823 Soluble
71 F H 0.0000 Buried
72 Q H -2.9096 Soluble
74 E H -3.0097 Soluble
75 R H -1.9805 Soluble
76 V H -1.2128 Soluble
77 T H -0.5377 Soluble
78 I H -0.2977 Soluble
79 T H -0.4520 Soluble
80 R H -0.9542 Soluble
81 D H -0.6571 Soluble
82 M H -0.1451 Soluble
83 S H -0.2909 Soluble
84 T H -0.4279 Soluble
85 S H -0.5686 Soluble
86 T H 0.0000 Buried
87 A H 0.0000 Buried
88 Y H -0.4545 Soluble
89 M H -0.4218 Soluble
90 E H -1.0106 Soluble
91 L H -0.8865 Soluble
92 S H -1.1611 Soluble
93 S H -1.0735 Soluble
94 L H 0.0000 Buried
95 R H -2.6321 Soluble
96 S H -2.0599 Soluble
97 E H -2.4716 Soluble
98 D H 0.0000 Buried
99 T H -0.8672 Soluble
100 A H -0.5282 Soluble
101 V H -0.0615 Soluble
102 Y H 0.0000 Buried
103 Y H -0.0017 Soluble
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 A H 0.0000 Buried
107 P H 0.0000 Buried
108 Y H 0.6993 Aggregation-prone
109 C H 0.0000 Buried
110 S H -0.2850 Soluble
111 G H -0.8170 Soluble
111A G H -0.8095 Soluble
112B S H -0.5035 Soluble
112A C H -0.0104 Soluble
112 F H -0.2173 Soluble
113 D H -1.2913 Soluble
114 G H 0.0000 Buried
115 F H 0.0000 Buried
116 D H -0.7151 Soluble
117 I H 0.0000 Buried
118 W H -0.2840 Soluble
119 G H 0.0000 Buried
120 Q H -1.0677 Soluble
121 G H 0.0000 Buried
122 T H 0.0000 Buried
123 M H 0.6625 Aggregation-prone
124 V H 0.0000 Buried
125 T H -0.1496 Soluble
126 V H -0.9061 Soluble
127 S H -0.5131 Soluble
128 S H -0.6292 Soluble
1 E L -0.9219 Soluble
2 I L 1.3002 Aggregation-prone
3 V L 1.2838 Aggregation-prone
4 L L 0.0914 Aggregation-prone
5 T L -0.0290 Soluble
6 Q L -0.8937 Soluble
7 S L -0.6332 Soluble
8 P L -0.6581 Soluble
9 G L -0.9956 Soluble
10 T L -1.1137 Soluble
11 L L -0.3300 Soluble
12 S L 0.0125 Aggregation-prone
13 L L 0.7377 Aggregation-prone
14 S L 0.1170 Aggregation-prone
15 P L -0.8398 Soluble
16 G L -1.6985 Soluble
17 E L 0.0000 Buried
18 R L -2.3417 Soluble
19 A L -1.0448 Soluble
20 T L -0.5150 Soluble
21 L L 0.0000 Buried
22 S L -0.9177 Soluble
23 C L 0.0000 Buried
24 R L -1.6855 Soluble
25 A L -1.1536 Soluble
26 S L -0.8969 Soluble
27 Q L -1.6536 Soluble
28 S L -1.1929 Soluble
29 V L -0.5641 Soluble
30 S L -0.2045 Soluble
36 S L -0.0984 Soluble
37 S L 0.0015 Aggregation-prone
38 Y L 0.6591 Aggregation-prone
39 L L 0.0000 Buried
40 A L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L -0.7793 Soluble
45 K L -1.1492 Soluble
46 P L -1.2582 Soluble
47 G L -1.6244 Soluble
48 Q L -1.9016 Soluble
49 A L -1.1678 Soluble
50 P L 0.0000 Buried
51 R L -0.6942 Soluble
52 L L 0.0000 Buried
53 L L 0.0000 Buried
54 I L 0.1274 Aggregation-prone
55 Y L 0.0390 Aggregation-prone
56 G L 0.0000 Buried
57 A L 0.0000 Buried
65 S L -0.3434 Soluble
66 S L -0.4823 Soluble
67 R L -0.6179 Soluble
68 A L -0.3676 Soluble
69 T L -0.1839 Soluble
70 G L -0.4418 Soluble
71 F L -0.0353 Soluble
72 P L -1.1295 Soluble
74 D L -2.8783 Soluble
75 R L -3.1994 Soluble
76 F L -1.6868 Soluble
77 S L -0.9667 Soluble
78 G L -0.2580 Soluble
79 S L -0.6634 Soluble
80 G L -1.0668 Soluble
83 S L -1.1665 Soluble
84 G L -1.3120 Soluble
85 T L -1.6739 Soluble
86 D L -2.4572 Soluble
87 F L 0.0000 Buried
88 T L -0.8535 Soluble
89 L L -0.2014 Soluble
90 T L -0.8461 Soluble
91 I L 0.0000 Buried
92 S L -2.6023 Soluble
93 R L -3.3484 Soluble
94 L L 0.0000 Buried
95 E L -2.2725 Soluble
96 P L -1.5275 Soluble
97 E L -1.8346 Soluble
98 D L -1.1709 Soluble
99 F L -0.7005 Soluble
100 A L 0.0000 Buried
101 V L 0.0000 Buried
102 Y L -0.3993 Soluble
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 Q L 0.0000 Buried
106 Q L -0.0960 Soluble
107 Y L -0.0582 Soluble
108 G L -0.7510 Soluble
109 N L -1.5336 Soluble
114 S L -0.8956 Soluble
115 P L -0.8804 Soluble
116 W L -0.3886 Soluble
117 T L -0.4153 Soluble
118 F L 0.0000 Buried
119 G L 0.0000 Buried
120 Q L -1.1768 Soluble
121 G L -1.4617 Soluble
122 T L 0.0000 Buried
123 K L -2.0540 Soluble
124 V L -0.9071 Soluble
125 E L -0.8589 Soluble
126 I L 1.1710 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.698 2.9366 CSV PDB
4.5 -0.7439 2.7681 CSV PDB
5.0 -0.8 2.532 CSV PDB
5.5 -0.8566 2.268 CSV PDB
6.0 -0.9036 2.0169 CSV PDB
6.5 -0.9328 1.8201 CSV PDB
7.0 -0.942 1.7148 CSV PDB
7.5 -0.9372 1.707 CSV PDB
8.0 -0.9249 1.7043 CSV PDB
8.5 -0.9075 1.7033 CSV PDB
9.0 -0.8851 1.7195 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH