Blontuvetmab / 9cq4

A4DAB051_9cq4_C_D | Source PDB: 9cq4 | Chains: C, D | Done
61.3
Yes
10 Å
Yes
Avg A4D Score
-0.6924
Max Score
1.3814
Min Score
-3.7096
Total Score
-156.48
Score CDR
-0.645
Score non-CDR
-0.7042

Calculation Parameters

Chain Sequence(s) QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSQIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAHFRGSGSGTSYSLTISGMEAEDAATYYCQQWSSNPFTFGSGTKLEIKR input.pdb
Selected Chain(s) C (Heavy), D (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.7096
Maximum Score 1.3814
Average Score -0.6924
Total Score -156.4813

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q C -1.5497 Soluble
2 V C 0.0000 Buried
3 Q C -2.0651 Soluble
4 L C 0.0000 Buried
5 Q C -2.0346 Soluble
6 Q C 0.0000 Buried
7 S C -0.9595 Soluble
8 G C -0.7253 Soluble
9 A C -0.0707 Soluble
11 E C -0.0616 Soluble
12 L C 0.8562 Aggregation-prone
13 A C -0.4709 Soluble
14 R C -1.9415 Soluble
15 P C -1.5679 Soluble
16 G C -1.2429 Soluble
17 A C -1.0606 Soluble
18 S C -1.2121 Soluble
19 V C 0.0000 Buried
20 K C -2.0308 Soluble
21 M C 0.0000 Buried
22 S C -0.8220 Soluble
23 C C 0.0000 Buried
24 K C -1.7084 Soluble
25 A C 0.0000 Buried
26 S C -1.2574 Soluble
27 G C -1.0280 Soluble
28 Y C -0.7050 Soluble
29 T C -0.6210 Soluble
30 F C 0.0000 Buried
35 T C -1.5808 Soluble
36 R C -1.8166 Soluble
37 Y C -1.0150 Soluble
38 T C -0.4470 Soluble
39 M C 0.0000 Buried
40 H C 0.0000 Buried
41 W C 0.0000 Buried
42 V C 0.0000 Buried
43 K C 0.0000 Buried
44 Q C -0.7494 Soluble
45 R C -1.2852 Soluble
46 P C -1.1407 Soluble
47 G C -1.2782 Soluble
48 Q C -1.7594 Soluble
49 G C -1.1021 Soluble
50 L C 0.0000 Buried
51 E C -0.9621 Soluble
52 W C 0.0000 Buried
53 I C 0.0000 Buried
54 G C 0.0000 Buried
55 Y C 0.0622 Aggregation-prone
56 I C 0.0000 Buried
57 N C -0.7585 Soluble
58 P C 0.0000 Buried
59 S C -1.5451 Soluble
62 R C -1.7355 Soluble
63 G C -0.8119 Soluble
64 Y C 0.3720 Aggregation-prone
65 T C -0.0429 Soluble
66 N C -0.8109 Soluble
67 Y C -1.4862 Soluble
68 N C -2.4004 Soluble
69 Q C -2.9793 Soluble
70 K C -3.1966 Soluble
71 F C 0.0000 Buried
72 K C -3.7096 Soluble
74 D C -3.2363 Soluble
75 K C -2.3010 Soluble
76 A C 0.0000 Buried
77 T C -1.1466 Soluble
78 L C 0.0000 Buried
79 T C -0.1480 Soluble
80 T C -1.0788 Soluble
81 D C -1.6839 Soluble
82 K C -2.2587 Soluble
83 S C -1.3460 Soluble
84 S C -1.2804 Soluble
85 S C -1.4337 Soluble
86 T C 0.0000 Buried
87 A C 0.0000 Buried
88 Y C -0.5723 Soluble
89 M C 0.0000 Buried
90 Q C -1.4411 Soluble
91 L C 0.0000 Buried
92 S C -1.3140 Soluble
93 S C -1.0473 Soluble
94 L C 0.0000 Buried
95 T C -1.2423 Soluble
96 S C -1.2469 Soluble
97 E C -2.0210 Soluble
98 D C 0.0000 Buried
99 S C -0.8010 Soluble
100 A C 0.0000 Buried
101 V C -0.0506 Soluble
102 Y C 0.0000 Buried
103 Y C 0.0000 Buried
104 C C 0.0000 Buried
105 A C 0.0000 Buried
106 R C 0.0000 Buried
107 Y C -0.1465 Soluble
108 Y C -1.0148 Soluble
109 D C -2.2696 Soluble
110 D C -2.5711 Soluble
112 H C -1.6535 Soluble
113 Y C -0.5865 Soluble
114 C C 0.0000 Buried
115 L C 0.0000 Buried
116 D C 0.0000 Buried
117 Y C -0.1859 Soluble
118 W C 0.0000 Buried
119 G C 0.0000 Buried
120 Q C -1.6297 Soluble
121 G C -0.8439 Soluble
122 T C 0.0000 Buried
123 T C -0.1786 Soluble
124 L C 0.0000 Buried
125 T C -0.0614 Soluble
126 V C 0.0000 Buried
127 S C -0.7335 Soluble
128 S C -0.8524 Soluble
1 Q D -0.8904 Soluble
2 I D 0.1882 Aggregation-prone
3 V D 1.3814 Aggregation-prone
4 L D 0.0000 Buried
5 T D 0.1910 Aggregation-prone
6 Q D 0.0000 Buried
7 S D -0.0479 Soluble
8 P D 0.1617 Aggregation-prone
9 A D 0.4091 Aggregation-prone
10 I D 1.3495 Aggregation-prone
11 M D 0.3402 Aggregation-prone
12 S D -0.6544 Soluble
13 A D -1.6227 Soluble
14 S D -2.2119 Soluble
15 P D -2.2620 Soluble
16 G D -2.1202 Soluble
17 E D -3.0438 Soluble
18 K D -2.7043 Soluble
19 V D -1.2556 Soluble
20 T D -0.7911 Soluble
21 M D 0.0000 Buried
22 T D -0.2384 Soluble
23 C D 0.0000 Buried
24 S D -0.0857 Soluble
25 A D 0.1749 Aggregation-prone
26 S D 0.0515 Aggregation-prone
27 S D -0.2886 Soluble
28 S D -0.5331 Soluble
29 V D 0.0000 Buried
37 S D -0.4297 Soluble
38 Y D -0.3004 Soluble
39 M D 0.0000 Buried
40 N D 0.0000 Buried
41 W D 0.0000 Buried
42 Y D 0.0000 Buried
43 Q D 0.0000 Buried
44 Q D 0.0000 Buried
45 K D -1.1720 Soluble
46 S D -0.6920 Soluble
47 G D -0.7228 Soluble
48 T D -0.8452 Soluble
49 S D -0.8411 Soluble
50 P D 0.0000 Buried
51 K D -1.0844 Soluble
52 R D -0.5721 Soluble
53 W D 0.0000 Buried
54 I D 0.0000 Buried
55 Y D 0.0000 Buried
56 D D -1.5529 Soluble
57 T D 0.0000 Buried
65 S D -1.6070 Soluble
66 K D -2.0326 Soluble
67 L D -0.8332 Soluble
68 A D -0.4445 Soluble
69 S D -0.3102 Soluble
70 G D -0.4171 Soluble
71 V D -0.0548 Soluble
72 P D -0.2918 Soluble
74 A D -0.3592 Soluble
75 H D -0.8455 Soluble
76 F D 0.0000 Buried
77 R D -2.1843 Soluble
78 G D -1.3425 Soluble
79 S D -1.1378 Soluble
80 G D -0.5682 Soluble
83 S D -0.6263 Soluble
84 G D -0.6856 Soluble
85 T D -0.5593 Soluble
86 S D -0.5196 Soluble
87 Y D 0.0000 Buried
88 S D -0.5430 Soluble
89 L D 0.0000 Buried
90 T D -1.1103 Soluble
91 I D 0.0000 Buried
92 S D -1.7319 Soluble
93 G D -1.8128 Soluble
94 M D 0.0000 Buried
95 E D -1.9975 Soluble
96 A D -1.2496 Soluble
97 E D -1.8093 Soluble
98 D D 0.0000 Buried
99 A D -1.2207 Soluble
100 A D 0.0000 Buried
101 T D -0.6245 Soluble
102 Y D 0.0000 Buried
103 Y D 0.0000 Buried
104 C D 0.0000 Buried
105 Q D 0.0000 Buried
106 Q D 0.0000 Buried
107 W D -0.1250 Soluble
108 S D -0.2693 Soluble
109 S D -0.9147 Soluble
114 N D -1.5931 Soluble
115 P D -1.1494 Soluble
116 F D 0.0000 Buried
117 T D -0.0983 Soluble
118 F D 0.0000 Buried
119 G D 0.0217 Aggregation-prone
120 S D -0.3660 Soluble
121 G D -0.5514 Soluble
122 T D 0.0000 Buried
123 K D -1.0441 Soluble
124 L D 0.0000 Buried
125 E D -1.0558 Soluble
126 I D -1.5337 Soluble
127 K D -2.6270 Soluble
128 R D -2.7056 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.899 1.7505 CSV PDB
4.5 -0.9318 1.7407 CSV PDB
5.0 -0.9693 1.7317 CSV PDB
5.5 -1.0035 1.7324 CSV PDB
6.0 -1.0244 1.7602 CSV PDB
6.5 -1.0244 1.8355 CSV PDB
7.0 -1.0041 1.9602 CSV PDB
7.5 -0.9707 2.1151 CSV PDB
8.0 -0.9303 2.2825 CSV PDB
8.5 -0.8847 2.4541 CSV PDB
9.0 -0.8338 2.6263 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH