Runimotamab / 6dn0

A4DAB231_6dn0_A_B | Source PDB: 6dn0 | Chains: A, B | Done
98.67
Yes
10 Å
Yes
Avg A4D Score
-0.5998
Max Score
1.6513
Min Score
-2.8378
Total Score
-134.95
Score CDR
-0.5229
Score non-CDR
-0.6201

Calculation Parameters

Chain Sequence(s) EVQLVESGGGLVQPGGSLRLSCAASGFNIDDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDVWGQGTLVTVSDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSADFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEI input.pdb
Selected Chain(s) A (Heavy), B (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.8378
Maximum Score 1.6513
Average Score -0.5998
Total Score -134.9532

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E A -1.9697 Soluble
2 V A -1.1738 Soluble
3 Q A -0.9549 Soluble
4 L A 0.0000 Buried
5 V A 0.9025 Aggregation-prone
6 E A 0.0000 Buried
7 S A -0.2542 Soluble
8 G A -0.4729 Soluble
9 G A 0.2052 Aggregation-prone
11 G A 0.8687 Aggregation-prone
12 L A 1.4342 Aggregation-prone
13 V A 0.0129 Aggregation-prone
14 Q A -1.2718 Soluble
15 P A -1.4522 Soluble
16 G A -1.4754 Soluble
17 G A -1.1328 Soluble
18 S A -1.0755 Soluble
19 L A -0.6800 Soluble
20 R A -1.4946 Soluble
21 L A 0.0000 Buried
22 S A -0.2581 Soluble
23 C A 0.0000 Buried
24 A A -0.2152 Soluble
25 A A -0.5236 Soluble
26 S A -0.9067 Soluble
27 G A -1.3577 Soluble
28 F A -1.4065 Soluble
29 N A -2.3361 Soluble
30 I A 0.0000 Buried
35 D A -2.3449 Soluble
36 D A -2.8378 Soluble
37 T A 0.0000 Buried
38 Y A -0.6870 Soluble
39 I A 0.0000 Buried
40 H A 0.0000 Buried
41 W A 0.0000 Buried
42 V A 0.0000 Buried
43 R A 0.0000 Buried
44 Q A -0.7160 Soluble
45 A A 0.0000 Buried
46 P A -1.2094 Soluble
47 G A -1.5624 Soluble
48 K A -2.3274 Soluble
49 G A -1.6056 Soluble
50 L A 0.0000 Buried
51 E A -1.0617 Soluble
52 W A 0.0000 Buried
53 V A 0.0000 Buried
54 A A 0.0000 Buried
55 R A -0.5032 Soluble
56 I A 0.0000 Buried
57 Y A -0.4714 Soluble
58 P A 0.0000 Buried
59 T A -1.1030 Soluble
62 N A -0.9854 Soluble
63 G A -0.3551 Soluble
64 Y A 0.5581 Aggregation-prone
65 T A -0.2831 Soluble
66 R A -1.5883 Soluble
67 Y A -1.7327 Soluble
68 A A -1.7733 Soluble
69 D A -2.6245 Soluble
70 S A -1.7555 Soluble
71 V A 0.0000 Buried
72 K A -2.7969 Soluble
74 G A -1.7333 Soluble
75 R A -1.4129 Soluble
76 F A 0.0000 Buried
77 T A -0.9436 Soluble
78 I A 0.0000 Buried
79 S A -0.1209 Soluble
80 A A -0.8817 Soluble
81 D A -1.4142 Soluble
82 T A -1.6998 Soluble
83 S A -1.5437 Soluble
84 K A -2.2356 Soluble
85 N A -1.7854 Soluble
86 T A 0.0000 Buried
87 A A 0.0000 Buried
88 Y A -0.4121 Soluble
89 L A 0.0000 Buried
90 Q A -0.8429 Soluble
91 M A 0.0000 Buried
92 N A -1.3013 Soluble
93 S A -1.3097 Soluble
94 L A 0.0000 Buried
95 R A -2.4180 Soluble
96 A A -1.7342 Soluble
97 E A -2.2431 Soluble
98 D A 0.0000 Buried
99 T A -0.3583 Soluble
100 A A 0.0000 Buried
101 V A 0.7223 Aggregation-prone
102 Y A 0.0000 Buried
103 Y A 0.0000 Buried
104 C A 0.0000 Buried
105 S A 0.0000 Buried
106 R A -0.7793 Soluble
107 W A -0.4407 Soluble
108 G A 0.0000 Buried
109 G A -0.7560 Soluble
110 D A -1.6156 Soluble
111 G A 0.2320 Aggregation-prone
112 F A 1.6467 Aggregation-prone
113 Y A 1.1150 Aggregation-prone
114 A A 0.0000 Buried
115 M A 0.0000 Buried
116 D A -0.0003 Soluble
117 V A 0.0000 Buried
118 W A 0.0000 Buried
119 G A 0.0000 Buried
120 Q A -1.2509 Soluble
121 G A -0.3475 Soluble
122 T A 0.5234 Aggregation-prone
123 L A 1.6513 Aggregation-prone
124 V A 0.0000 Buried
125 T A 0.4286 Aggregation-prone
126 V A -0.4525 Soluble
127 S A -0.4404 Soluble
1 D B -2.2361 Soluble
2 I B 0.0000 Buried
3 Q B -2.2430 Soluble
4 M B 0.0000 Buried
5 T B -1.3790 Soluble
6 Q B 0.0000 Buried
7 S B -0.7536 Soluble
8 P B -0.6089 Soluble
9 S B -0.8290 Soluble
10 S B -0.9024 Soluble
11 L B -0.3721 Soluble
12 S B -0.2724 Soluble
13 A B 0.0064 Aggregation-prone
14 S B 0.1535 Aggregation-prone
15 V B 0.7331 Aggregation-prone
16 G B -0.8606 Soluble
17 D B -1.7499 Soluble
18 R B -2.3501 Soluble
19 V B 0.0000 Buried
20 T B -0.5171 Soluble
21 I B 0.0000 Buried
22 T B -0.8018 Soluble
23 C B 0.0000 Buried
24 R B -2.7472 Soluble
25 A B 0.0000 Buried
26 S B -2.0875 Soluble
27 Q B -2.6050 Soluble
28 D B -2.7587 Soluble
29 V B 0.0000 Buried
36 N B -1.9114 Soluble
37 T B -1.2119 Soluble
38 A B -0.2028 Soluble
39 V B 0.0000 Buried
40 A B 0.0000 Buried
41 W B 0.0000 Buried
42 Y B 0.0000 Buried
43 Q B 0.0000 Buried
44 Q B 0.0000 Buried
45 K B -1.5514 Soluble
46 P B -1.1184 Soluble
47 G B -1.6653 Soluble
48 K B -2.5292 Soluble
49 A B -1.6405 Soluble
50 P B 0.0000 Buried
51 K B -1.2261 Soluble
52 L B 0.0000 Buried
53 L B 0.0000 Buried
54 I B 0.0000 Buried
55 Y B 0.0000 Buried
56 S B 0.0000 Buried
57 A B 0.0000 Buried
65 D B -1.3695 Soluble
66 F B 0.8340 Aggregation-prone
67 L B 0.7625 Aggregation-prone
68 Y B 0.4506 Aggregation-prone
69 S B 0.0190 Aggregation-prone
70 G B -0.4449 Soluble
71 V B 0.0000 Buried
72 P B -0.3527 Soluble
74 S B -0.4337 Soluble
75 R B -0.8741 Soluble
76 F B 0.0000 Buried
77 S B -0.4800 Soluble
78 G B -0.9105 Soluble
79 S B -1.5571 Soluble
80 R B -2.5810 Soluble
83 S B -1.5243 Soluble
84 G B -1.8528 Soluble
85 T B -2.2283 Soluble
86 D B -2.0400 Soluble
87 F B 0.0000 Buried
88 T B -1.1260 Soluble
89 L B 0.0000 Buried
90 T B -0.6472 Soluble
91 I B 0.0000 Buried
92 S B -1.4888 Soluble
93 S B -1.2384 Soluble
94 L B 0.0000 Buried
95 Q B -0.6112 Soluble
96 P B -0.5920 Soluble
97 E B -1.4951 Soluble
98 D B 0.0000 Buried
99 F B 0.0215 Aggregation-prone
100 A B 0.0000 Buried
101 T B -0.7879 Soluble
102 Y B 0.0000 Buried
103 Y B 0.0000 Buried
104 C B 0.0000 Buried
105 Q B 0.0000 Buried
106 Q B 0.0000 Buried
107 H B 0.0000 Buried
108 Y B 0.8379 Aggregation-prone
109 T B 0.2707 Aggregation-prone
114 T B -0.3252 Soluble
115 P B -0.4880 Soluble
116 P B 0.0000 Buried
117 T B -0.6042 Soluble
118 F B -0.4683 Soluble
119 G B 0.0000 Buried
120 Q B -1.9244 Soluble
121 G B 0.0000 Buried
122 T B 0.0000 Buried
123 K B -1.4129 Soluble
124 V B 0.0000 Buried
125 E B -0.5653 Soluble
126 I B 1.4221 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.481 4.6838 CSV PDB
4.5 -0.5305 4.581 CSV PDB
5.0 -0.5876 4.4634 CSV PDB
5.5 -0.6449 4.3402 CSV PDB
6.0 -0.6952 4.2151 CSV PDB
6.5 -0.733 4.0896 CSV PDB
7.0 -0.758 3.9648 CSV PDB
7.5 -0.7739 3.8423 CSV PDB
8.0 -0.7833 3.7257 CSV PDB
8.5 -0.7853 3.623 CSV PDB
9.0 -0.7774 3.546 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH