Evunzekibart / 8oz3

A4DAB113_8oz3_H_L | Source PDB: 8oz3 | Chains: H, L | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5096
Max Score
1.4178
Min Score
-2.5593
Total Score
-115.17
Score CDR
-0.0806
Score non-CDR
-0.6193

Calculation Parameters

Chain Sequence(s) EVQLLESGGGLVQPGGSLRLSCAASGFNFGYSYMSWVRQAPGKGLEWVSSIGSTSSHTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVYSSPGIDYWGQGTLVTVSSDIQMTQSPSSLSASVGDRVTITCRASQSIGSTLNWYQQKPGKAPKLLIYGASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYTWVPFTFGQGTKLEIK input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.5593
Maximum Score 1.4178
Average Score -0.5096
Total Score -115.1719

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E H -1.9746 Soluble
2 V H -1.0465 Soluble
3 Q H -0.9339 Soluble
4 L H 0.0000 Buried
5 L H 0.6174 Aggregation-prone
6 E H 0.0000 Buried
7 S H -0.3357 Soluble
8 G H -0.7468 Soluble
9 G H 0.0538 Aggregation-prone
11 G H 0.6559 Aggregation-prone
12 L H 1.4178 Aggregation-prone
13 V H 0.0157 Aggregation-prone
14 Q H -1.2388 Soluble
15 P H -1.4371 Soluble
16 G H -1.3079 Soluble
17 G H -0.8670 Soluble
18 S H -0.9432 Soluble
19 L H -0.6600 Soluble
20 R H -1.6245 Soluble
21 L H 0.0000 Buried
22 S H -0.3264 Soluble
23 C H 0.0000 Buried
24 A H -0.1661 Soluble
25 A H 0.0000 Buried
26 S H -1.1995 Soluble
27 G H -1.3484 Soluble
28 F H -0.7711 Soluble
29 N H -1.0027 Soluble
30 F H 0.0000 Buried
35 G H -0.3988 Soluble
36 Y H 0.7499 Aggregation-prone
37 S H 0.0000 Buried
38 Y H 0.3604 Aggregation-prone
39 M H 0.0000 Buried
40 S H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H 0.0000 Buried
44 Q H 0.0000 Buried
45 A H -1.0227 Soluble
46 P H -0.9413 Soluble
47 G H -1.5320 Soluble
48 K H -2.3946 Soluble
49 G H -1.6733 Soluble
50 L H 0.0000 Buried
51 E H -1.6771 Soluble
52 W H 0.0000 Buried
53 V H 0.0000 Buried
54 S H 0.0000 Buried
55 S H 0.0000 Buried
56 I H 0.0000 Buried
57 G H -0.2171 Soluble
58 S H -0.0913 Soluble
59 T H -0.2405 Soluble
62 S H -0.7481 Soluble
63 S H -0.6925 Soluble
64 H H -0.8978 Soluble
65 T H -0.2951 Soluble
66 Y H 0.1557 Aggregation-prone
67 Y H -0.4442 Soluble
68 A H -1.1644 Soluble
69 D H -2.2327 Soluble
70 S H -1.7456 Soluble
71 V H 0.0000 Buried
72 K H -2.5042 Soluble
74 G H -1.7283 Soluble
75 R H -1.4225 Soluble
76 F H 0.0000 Buried
77 T H -0.7069 Soluble
78 I H 0.0000 Buried
79 S H -0.4776 Soluble
80 R H -0.9837 Soluble
81 D H -1.5714 Soluble
82 N H -1.8252 Soluble
83 S H -1.7018 Soluble
84 K H -2.4345 Soluble
85 N H -2.0764 Soluble
86 T H -1.0882 Soluble
87 L H 0.0000 Buried
88 Y H -0.4330 Soluble
89 L H 0.0000 Buried
90 Q H -0.9821 Soluble
91 M H 0.0000 Buried
92 N H -1.3197 Soluble
93 S H -1.1988 Soluble
94 L H 0.0000 Buried
95 R H -2.1639 Soluble
96 A H -1.6666 Soluble
97 E H -2.1791 Soluble
98 D H 0.0000 Buried
99 T H -0.3738 Soluble
100 A H 0.0000 Buried
101 V H 0.4611 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 R H 0.0000 Buried
107 V H 0.0000 Buried
108 Y H 0.4602 Aggregation-prone
109 S H 0.0908 Aggregation-prone
110 S H -0.0955 Soluble
113 P H 0.0848 Aggregation-prone
114 G H 0.0000 Buried
115 I H 0.0000 Buried
116 D H -0.2746 Soluble
117 Y H 0.1379 Aggregation-prone
118 W H 0.0000 Buried
119 G H 0.0000 Buried
120 Q H -1.3368 Soluble
121 G H -0.3912 Soluble
122 T H 0.2887 Aggregation-prone
123 L H 1.2200 Aggregation-prone
124 V H 0.0000 Buried
125 T H 0.3468 Aggregation-prone
126 V H 0.0000 Buried
127 S H -0.3980 Soluble
128 S H -0.4934 Soluble
1 D L -2.0908 Soluble
2 I L 0.0000 Buried
3 Q L -2.1495 Soluble
4 M L 0.0000 Buried
5 T L -1.3121 Soluble
6 Q L 0.0000 Buried
7 S L -0.6245 Soluble
8 P L -0.5995 Soluble
9 S L -0.8883 Soluble
10 S L -0.9905 Soluble
11 L L -0.5396 Soluble
12 S L -0.6058 Soluble
13 A L 0.0000 Buried
14 S L -0.1697 Soluble
15 V L 0.4422 Aggregation-prone
16 G L -0.7849 Soluble
17 D L -1.6512 Soluble
18 R L -2.3356 Soluble
19 V L 0.0000 Buried
20 T L -0.5878 Soluble
21 I L 0.0000 Buried
22 T L -0.7815 Soluble
23 C L 0.0000 Buried
24 R L -2.3277 Soluble
25 A L 0.0000 Buried
26 S L -1.7099 Soluble
27 Q L -1.6081 Soluble
28 S L -0.9845 Soluble
29 I L 0.0000 Buried
36 G L -0.5741 Soluble
37 S L -0.3681 Soluble
38 T L 0.1361 Aggregation-prone
39 L L 0.0000 Buried
40 N L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L 0.0000 Buried
45 K L -1.7353 Soluble
46 P L -1.2633 Soluble
47 G L -1.7473 Soluble
48 K L -2.5593 Soluble
49 A L -1.6316 Soluble
50 P L 0.0000 Buried
51 K L -1.5702 Soluble
52 L L 0.0000 Buried
53 L L 0.0000 Buried
54 I L 0.0000 Buried
55 Y L 0.1608 Aggregation-prone
56 G L -0.1570 Soluble
57 A L 0.0000 Buried
65 S L -0.3214 Soluble
66 S L -0.0411 Soluble
67 L L 0.1923 Aggregation-prone
68 Q L -0.3706 Soluble
69 S L -0.4289 Soluble
70 G L -0.4984 Soluble
71 V L -0.3365 Soluble
72 P L -0.3424 Soluble
74 S L -0.4356 Soluble
75 R L -0.9784 Soluble
76 F L 0.0000 Buried
77 S L -0.3186 Soluble
78 G L -0.2775 Soluble
79 S L -0.6557 Soluble
80 G L -1.0600 Soluble
83 S L -0.9563 Soluble
84 G L -1.1825 Soluble
85 T L -1.6033 Soluble
86 D L -2.1155 Soluble
87 F L 0.0000 Buried
88 T L -0.7116 Soluble
89 L L 0.0000 Buried
90 T L -0.6408 Soluble
91 I L 0.0000 Buried
92 S L -1.6401 Soluble
93 S L -1.2859 Soluble
94 L L 0.0000 Buried
95 Q L -1.0229 Soluble
96 P L -0.7538 Soluble
97 E L -1.9236 Soluble
98 D L 0.0000 Buried
99 F L -0.5600 Soluble
100 A L 0.0000 Buried
101 T L -1.0059 Soluble
102 Y L 0.0000 Buried
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 Q L 0.0000 Buried
106 Q L 0.0000 Buried
107 Y L 0.9624 Aggregation-prone
108 Y L 1.2983 Aggregation-prone
109 T L 0.8540 Aggregation-prone
113 W L 1.2500 Aggregation-prone
114 V L 1.1531 Aggregation-prone
115 P L 0.3412 Aggregation-prone
116 F L 0.0000 Buried
117 T L -0.4988 Soluble
118 F L -0.5724 Soluble
119 G L 0.0000 Buried
120 Q L -1.7703 Soluble
121 G L 0.0000 Buried
122 T L 0.0000 Buried
123 K L -1.8374 Soluble
124 L L 0.0000 Buried
125 E L -0.6281 Soluble
126 I L 0.9463 Aggregation-prone
127 K L -0.7370 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6086 2.0512 CSV PDB
4.5 -0.6395 2.0512 CSV PDB
5.0 -0.674 2.0512 CSV PDB
5.5 -0.7058 2.0512 CSV PDB
6.0 -0.7273 2.0512 CSV PDB
6.5 -0.7334 2.0512 CSV PDB
7.0 -0.7253 2.0512 CSV PDB
7.5 -0.7079 2.0511 CSV PDB
8.0 -0.6847 2.0511 CSV PDB
8.5 -0.6561 2.0508 CSV PDB
9.0 -0.6228 2.0534 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH