Evunzekibart / 8oz3

A4DAB113_8oz3_A_B | Source PDB: 8oz3 | Chains: A, B | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5008
Max Score
1.4455
Min Score
-2.5976
Total Score
-112.69
Score CDR
0.0397
Score non-CDR
-0.6398

Calculation Parameters

Chain Sequence(s) VQLLESGGGLVQPGGSLRLSCAASGFNFGYSYMSWVRQAPGKGLEWVSSIGSTSSHTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVYSSPGIDYWGQGTLVTVSSDIQMTQSPSSLSASVGDRVTITCRASQSIGSTLNWYQQKPGKAPKLLIYGASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYTWVPFTFGQGTKLEIK input.pdb
Selected Chain(s) A (Heavy), B (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.5976
Maximum Score 1.4455
Average Score -0.5008
Total Score -112.6899

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V A 1.0090 Aggregation-prone
3 Q A -0.1163 Soluble
4 L A 0.0000 Buried
5 L A 0.1899 Aggregation-prone
6 E A 0.0000 Buried
7 S A -0.4187 Soluble
8 G A -0.7395 Soluble
9 G A 0.0922 Aggregation-prone
11 G A 0.8636 Aggregation-prone
12 L A 1.4455 Aggregation-prone
13 V A 0.0083 Aggregation-prone
14 Q A -1.3009 Soluble
15 P A -1.6165 Soluble
16 G A -1.4727 Soluble
17 G A -1.0828 Soluble
18 S A -1.2855 Soluble
19 L A -0.7971 Soluble
20 R A -1.7238 Soluble
21 L A 0.0000 Buried
22 S A -0.4179 Soluble
23 C A 0.0000 Buried
24 A A -0.3121 Soluble
25 A A 0.0000 Buried
26 S A -0.4653 Soluble
27 G A -0.0847 Soluble
28 F A 0.1794 Aggregation-prone
29 N A -0.1990 Soluble
30 F A 0.0000 Buried
35 G A -0.0651 Soluble
36 Y A 1.1322 Aggregation-prone
37 S A 0.0000 Buried
38 Y A 0.5658 Aggregation-prone
39 M A 0.0000 Buried
40 S A 0.0000 Buried
41 W A 0.0000 Buried
42 V A 0.0000 Buried
43 R A 0.0000 Buried
44 Q A -0.8691 Soluble
45 A A -1.1065 Soluble
46 P A -0.8742 Soluble
47 G A -1.4638 Soluble
48 K A -2.4334 Soluble
49 G A -1.6945 Soluble
50 L A 0.0000 Buried
51 E A -1.7044 Soluble
52 W A 0.0000 Buried
53 V A 0.0000 Buried
54 S A 0.0000 Buried
55 S A 0.0000 Buried
56 I A 0.0000 Buried
57 G A -0.1386 Soluble
58 S A 0.1460 Aggregation-prone
59 T A -0.1954 Soluble
62 S A -0.5773 Soluble
63 S A -0.6461 Soluble
64 H A -0.8223 Soluble
65 T A -0.2301 Soluble
66 Y A 0.2162 Aggregation-prone
67 Y A -0.4033 Soluble
68 A A -1.1881 Soluble
69 D A -2.2502 Soluble
70 S A -1.7616 Soluble
71 V A 0.0000 Buried
72 K A -2.4312 Soluble
74 G A -1.6580 Soluble
75 R A 0.0000 Buried
76 F A 0.0000 Buried
77 T A -0.7098 Soluble
78 I A 0.0000 Buried
79 S A -0.4763 Soluble
80 R A -0.9646 Soluble
81 D A -1.5448 Soluble
82 N A -1.6920 Soluble
83 S A -1.6616 Soluble
84 K A -2.4001 Soluble
85 N A -1.9081 Soluble
86 T A -1.0836 Soluble
87 L A 0.0000 Buried
88 Y A -0.4541 Soluble
89 L A 0.0000 Buried
90 Q A -1.0744 Soluble
91 M A 0.0000 Buried
92 N A -1.6036 Soluble
93 S A -1.3633 Soluble
94 L A 0.0000 Buried
95 R A -2.2787 Soluble
96 A A -1.7419 Soluble
97 E A -2.2346 Soluble
98 D A 0.0000 Buried
99 T A -0.3936 Soluble
100 A A 0.0000 Buried
101 V A 0.5546 Aggregation-prone
102 Y A 0.0000 Buried
103 Y A 0.0000 Buried
104 C A 0.0000 Buried
105 A A 0.0000 Buried
106 R A 0.0000 Buried
107 V A 0.0000 Buried
108 Y A 0.9116 Aggregation-prone
109 S A 0.2686 Aggregation-prone
110 S A 0.0193 Aggregation-prone
113 P A 0.2100 Aggregation-prone
114 G A 0.0000 Buried
115 I A 0.0000 Buried
116 D A -0.0531 Soluble
117 Y A 0.6739 Aggregation-prone
118 W A 0.0459 Aggregation-prone
119 G A 0.0000 Buried
120 Q A -1.5004 Soluble
121 G A 0.0000 Buried
122 T A 0.3037 Aggregation-prone
123 L A 1.3084 Aggregation-prone
124 V A 0.0000 Buried
125 T A 0.3682 Aggregation-prone
126 V A 0.0000 Buried
127 S A -0.4038 Soluble
128 S A -0.8978 Soluble
1 D B -2.0817 Soluble
2 I B 0.0000 Buried
3 Q B -2.1308 Soluble
4 M B 0.0000 Buried
5 T B -1.2984 Soluble
6 Q B 0.0000 Buried
7 S B -0.5498 Soluble
8 P B -0.6288 Soluble
9 S B -0.9357 Soluble
10 S B -1.2685 Soluble
11 L B -0.8289 Soluble
12 S B -0.8396 Soluble
13 A B -0.4738 Soluble
14 S B -0.1946 Soluble
15 V B 0.3693 Aggregation-prone
16 G B -0.9322 Soluble
17 D B -1.9358 Soluble
18 R B -2.4892 Soluble
19 V B 0.0000 Buried
20 T B -0.5049 Soluble
21 I B 0.0000 Buried
22 T B -0.8433 Soluble
23 C B 0.0000 Buried
24 R B -2.3869 Soluble
25 A B 0.0000 Buried
26 S B -1.7729 Soluble
27 Q B -1.6907 Soluble
28 S B -1.0846 Soluble
29 I B 0.0000 Buried
36 G B -0.6172 Soluble
37 S B -0.3933 Soluble
38 T B 0.1001 Aggregation-prone
39 L B 0.0000 Buried
40 N B 0.0000 Buried
41 W B 0.0000 Buried
42 Y B 0.0000 Buried
43 Q B 0.0000 Buried
44 Q B -1.3802 Soluble
45 K B -1.8802 Soluble
46 P B -1.2644 Soluble
47 G B -1.7122 Soluble
48 K B -2.5976 Soluble
49 A B -1.5616 Soluble
50 P B 0.0000 Buried
51 K B -1.4049 Soluble
52 L B 0.0000 Buried
53 L B 0.0000 Buried
54 I B 0.0000 Buried
55 Y B 0.1704 Aggregation-prone
56 G B -0.1579 Soluble
57 A B 0.0000 Buried
65 S B -0.3330 Soluble
66 S B -0.0449 Soluble
67 L B 0.1889 Aggregation-prone
68 Q B -0.3131 Soluble
69 S B -0.4114 Soluble
70 G B -0.5003 Soluble
71 V B -0.3319 Soluble
72 P B -0.3410 Soluble
74 S B -0.4153 Soluble
75 R B -0.8987 Soluble
76 F B 0.0000 Buried
77 S B -0.3467 Soluble
78 G B -0.3088 Soluble
79 S B -0.7643 Soluble
80 G B -1.2249 Soluble
83 S B -1.1011 Soluble
84 G B -1.3286 Soluble
85 T B -1.8324 Soluble
86 D B -2.5788 Soluble
87 F B 0.0000 Buried
88 T B -0.8175 Soluble
89 L B 0.0000 Buried
90 T B -0.6644 Soluble
91 I B 0.0000 Buried
92 S B -1.5344 Soluble
93 S B -1.2715 Soluble
94 L B 0.0000 Buried
95 Q B -1.1596 Soluble
96 P B -0.7642 Soluble
97 E B -1.9038 Soluble
98 D B 0.0000 Buried
99 F B -0.8467 Soluble
100 A B 0.0000 Buried
101 T B -1.3078 Soluble
102 Y B 0.0000 Buried
103 Y B 0.0000 Buried
104 C B 0.0000 Buried
105 Q B 0.0000 Buried
106 Q B 0.0000 Buried
107 Y B 0.9019 Aggregation-prone
108 Y B 1.1658 Aggregation-prone
109 T B 0.7821 Aggregation-prone
113 W B 1.1892 Aggregation-prone
114 V B 1.1003 Aggregation-prone
115 P B 0.2841 Aggregation-prone
116 F B 0.0000 Buried
117 T B -0.5136 Soluble
118 F B -0.5591 Soluble
119 G B 0.0000 Buried
120 Q B -1.7991 Soluble
121 G B 0.0000 Buried
122 T B 0.0000 Buried
123 K B -2.3762 Soluble
124 L B 0.0000 Buried
125 E B -1.5930 Soluble
126 I B 0.5381 Aggregation-prone
127 K B -0.9795 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.5794 2.0847 CSV PDB
4.5 -0.6117 2.0847 CSV PDB
5.0 -0.6477 2.0847 CSV PDB
5.5 -0.6806 2.0847 CSV PDB
6.0 -0.7028 2.0847 CSV PDB
6.5 -0.7092 2.0847 CSV PDB
7.0 -0.7015 2.0847 CSV PDB
7.5 -0.6846 2.0847 CSV PDB
8.0 -0.662 2.0847 CSV PDB
8.5 -0.6342 2.0847 CSV PDB
9.0 -0.601 2.0847 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH