Vebanvibart / 7y0w

A4DAB289_7y0w_A_B | Source PDB: 7y0w | Chains: A, B | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.649
Max Score
1.8565
Min Score
-3.1472
Total Score
-149.28
Score CDR
-0.5709
Score non-CDR
-0.6724

Calculation Parameters

Chain Sequence(s) QVQLVQSGAEVKKPGSSVKVSCKASGGTFRSHVISWVRQAPGQGLEWMGGFIPLFGTTIYAQAFQGRVMISADESTSTAYMELSSLRSEDTAVYFCARLFPNGDPNSPEDGFDIWGQGTLVTVDIQMTQSPSSLSASVGDRVTITCQASQDIGNYLNWYQQKPGKAPKLLIYDASHLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQRYDDLPSYTFGQGTKVEI input.pdb
Selected Chain(s) A (Heavy), B (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.1472
Maximum Score 1.8565
Average Score -0.649
Total Score -149.2804

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q A -1.9849 Soluble
2 V A -1.3557 Soluble
3 Q A -1.6411 Soluble
4 L A 0.0000 Buried
5 V A -0.3935 Soluble
6 Q A -0.6440 Soluble
7 S A -0.9313 Soluble
8 G A -0.3948 Soluble
9 A A 0.1101 Aggregation-prone
11 E A -0.2486 Soluble
12 V A 0.9889 Aggregation-prone
13 K A -0.7462 Soluble
14 K A -1.9344 Soluble
15 P A -2.1486 Soluble
16 G A -1.4966 Soluble
17 S A -1.1635 Soluble
18 S A -1.4008 Soluble
19 V A 0.0000 Buried
20 K A -2.0823 Soluble
21 V A 0.0000 Buried
22 S A -0.8476 Soluble
23 C A 0.0000 Buried
24 K A -1.5476 Soluble
25 A A 0.0000 Buried
26 S A -1.1242 Soluble
27 G A -1.2595 Soluble
28 G A -1.2584 Soluble
29 T A -1.3033 Soluble
30 F A 0.0000 Buried
35 R A -2.0249 Soluble
36 S A -1.0517 Soluble
37 H A 0.0000 Buried
38 V A 0.0636 Aggregation-prone
39 I A 0.0000 Buried
40 S A 0.0000 Buried
41 W A 0.0000 Buried
42 V A 0.0000 Buried
43 R A 0.0000 Buried
44 Q A -0.6214 Soluble
45 A A -0.9789 Soluble
46 P A -0.7326 Soluble
47 G A -1.2185 Soluble
48 Q A -1.8976 Soluble
49 G A -1.4265 Soluble
50 L A 0.0000 Buried
51 E A -1.1963 Soluble
52 W A 0.0000 Buried
53 M A 0.0000 Buried
54 G A 0.0000 Buried
55 G A 0.0000 Buried
56 F A 0.7578 Aggregation-prone
57 I A 0.6198 Aggregation-prone
58 P A 0.0000 Buried
59 L A 0.8803 Aggregation-prone
62 F A 1.8565 Aggregation-prone
63 G A 0.6712 Aggregation-prone
64 T A 0.6096 Aggregation-prone
65 T A 0.5298 Aggregation-prone
66 I A 0.3123 Aggregation-prone
67 Y A -0.2943 Soluble
68 A A -0.9484 Soluble
69 Q A -1.8860 Soluble
70 A A -1.0615 Soluble
71 F A 0.0000 Buried
72 Q A -1.7958 Soluble
74 G A -1.2776 Soluble
75 R A -1.1454 Soluble
76 V A 0.0000 Buried
77 M A -0.1368 Soluble
78 I A 0.0000 Buried
79 S A -0.4359 Soluble
80 A A -1.2030 Soluble
81 D A -2.3596 Soluble
82 E A -3.1472 Soluble
83 S A -1.7611 Soluble
84 T A -1.4406 Soluble
85 S A -1.9972 Soluble
86 T A 0.0000 Buried
87 A A 0.0000 Buried
88 Y A -0.5692 Soluble
89 M A 0.0000 Buried
90 E A -1.3988 Soluble
91 L A 0.0000 Buried
92 S A -1.0361 Soluble
93 S A -1.0428 Soluble
94 L A 0.0000 Buried
95 R A -2.7634 Soluble
96 S A -2.1025 Soluble
97 E A -2.4086 Soluble
98 D A 0.0000 Buried
99 T A -0.4894 Soluble
100 A A 0.0000 Buried
101 V A 0.4577 Aggregation-prone
102 Y A 0.0000 Buried
103 F A 0.0000 Buried
104 C A 0.0000 Buried
105 A A 0.0000 Buried
106 R A 0.0000 Buried
107 L A 0.0000 Buried
108 F A 0.0000 Buried
109 P A -0.1126 Soluble
110 N A 0.0000 Buried
111 G A -0.6117 Soluble
111A D A -1.4559 Soluble
111B P A -1.3957 Soluble
112C N A -2.0839 Soluble
112B S A -2.0717 Soluble
112A P A -2.0181 Soluble
112 E A -2.7208 Soluble
113 D A -2.1021 Soluble
114 G A -0.9396 Soluble
115 F A 0.3294 Aggregation-prone
116 D A -0.0140 Soluble
117 I A -0.1731 Soluble
118 W A 0.0000 Buried
119 G A -0.9763 Soluble
120 Q A -1.5694 Soluble
121 G A -0.6819 Soluble
122 T A 0.0000 Buried
123 L A 0.9290 Aggregation-prone
124 V A 0.0000 Buried
125 T A 0.1086 Aggregation-prone
126 V A -0.6970 Soluble
1 D B -2.3154 Soluble
2 I B -1.7466 Soluble
3 Q B -1.8704 Soluble
4 M B 0.0000 Buried
5 T B -0.9421 Soluble
6 Q B 0.0000 Buried
7 S B -0.6519 Soluble
8 P B -0.6151 Soluble
9 S B -0.8737 Soluble
10 S B -0.8456 Soluble
11 L B -0.3732 Soluble
12 S B -0.2959 Soluble
13 A B -0.1028 Soluble
14 S B 0.2018 Aggregation-prone
15 V B 0.5818 Aggregation-prone
16 G B -0.8093 Soluble
17 D B -1.5939 Soluble
18 R B -2.2304 Soluble
19 V B 0.0000 Buried
20 T B -0.5472 Soluble
21 I B 0.0000 Buried
22 T B -0.7344 Soluble
23 C B 0.0000 Buried
24 Q B -1.8699 Soluble
25 A B -1.8493 Soluble
26 S B -2.0630 Soluble
27 Q B -2.7906 Soluble
28 D B -2.7142 Soluble
29 I B -1.2879 Soluble
36 G B -1.2480 Soluble
37 N B -1.2170 Soluble
38 Y B -0.5959 Soluble
39 L B 0.0000 Buried
40 N B 0.0000 Buried
41 W B 0.0000 Buried
42 Y B 0.0000 Buried
43 Q B 0.0000 Buried
44 Q B 0.0000 Buried
45 K B -1.5100 Soluble
46 P B -1.1257 Soluble
47 G B -1.6802 Soluble
48 K B -2.5499 Soluble
49 A B -1.6900 Soluble
50 P B 0.0000 Buried
51 K B -1.6636 Soluble
52 L B 0.0000 Buried
53 L B 0.0000 Buried
54 I B 0.0000 Buried
55 Y B -0.0134 Soluble
56 D B -0.5733 Soluble
57 A B 0.0000 Buried
65 S B -0.6481 Soluble
66 H B -0.5994 Soluble
67 L B -0.0552 Soluble
68 E B -0.1837 Soluble
69 T B -0.5337 Soluble
70 G B -0.6386 Soluble
71 V B -0.2253 Soluble
72 P B -0.3269 Soluble
74 S B -0.3982 Soluble
75 R B -0.6831 Soluble
76 F B 0.0000 Buried
77 S B -0.3643 Soluble
78 G B 0.0000 Buried
79 S B -0.8592 Soluble
80 G B -1.3164 Soluble
83 S B -1.4624 Soluble
84 G B -1.9402 Soluble
85 T B -2.3345 Soluble
86 D B -2.6224 Soluble
87 F B 0.0000 Buried
88 T B -0.7284 Soluble
89 F B 0.0000 Buried
90 T B -0.5571 Soluble
91 I B 0.0000 Buried
92 S B -1.1656 Soluble
93 S B -1.0578 Soluble
94 L B 0.0000 Buried
95 Q B -0.6537 Soluble
96 P B -0.7115 Soluble
97 E B -1.6785 Soluble
98 D B 0.0000 Buried
99 I B -0.3431 Soluble
100 A B 0.0000 Buried
101 T B 0.0000 Buried
102 Y B 0.0000 Buried
103 Y B 0.0000 Buried
104 C B 0.0000 Buried
105 Q B 0.0000 Buried
106 R B 0.0000 Buried
107 Y B -0.2656 Soluble
108 D B -0.8364 Soluble
109 D B -1.3787 Soluble
113 L B 0.2178 Aggregation-prone
114 P B 0.0278 Aggregation-prone
115 S B -0.0614 Soluble
116 Y B 0.0000 Buried
117 T B -0.6064 Soluble
118 F B 0.0000 Buried
119 G B 0.0000 Buried
120 Q B -1.7324 Soluble
121 G B 0.0000 Buried
122 T B 0.0000 Buried
123 K B -1.1576 Soluble
124 V B 0.0000 Buried
125 E B -0.3590 Soluble
126 I B 1.3207 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.3809 4.1333 CSV PDB
4.5 -0.4332 4.1333 CSV PDB
5.0 -0.4969 4.1333 CSV PDB
5.5 -0.5622 4.1333 CSV PDB
6.0 -0.6192 4.1333 CSV PDB
6.5 -0.6603 4.1333 CSV PDB
7.0 -0.684 4.1333 CSV PDB
7.5 -0.6951 4.1333 CSV PDB
8.0 -0.6989 4.1333 CSV PDB
8.5 -0.6963 4.1333 CSV PDB
9.0 -0.6856 4.1333 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH