Diridavumab / 8dis

A4DAB087_8dis_A_C | Source PDB: 8dis | Chains: A, C | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.4818
Max Score
2.9756
Min Score
-3.0648
Total Score
-109.85
Score CDR
-0.0908
Score non-CDR
-0.6002

Calculation Parameters

Chain Sequence(s) VQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRRPTAYVVFGGGTKLTVL input.pdb
Selected Chain(s) A (Heavy), C (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.0648
Maximum Score 2.9756
Average Score -0.4818
Total Score -109.8529

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V A 1.0834 Aggregation-prone
3 Q A -0.6303 Soluble
4 L A 0.0000 Buried
5 V A -0.5209 Soluble
6 E A -0.6775 Soluble
7 S A -0.8119 Soluble
8 G A -0.6926 Soluble
9 A A -0.2975 Soluble
11 E A -0.4808 Soluble
12 V A 0.6777 Aggregation-prone
13 K A -0.8703 Soluble
14 K A -2.1752 Soluble
15 P A -2.2724 Soluble
16 G A -1.6230 Soluble
17 S A -1.2382 Soluble
18 S A -1.3102 Soluble
19 V A 0.0000 Buried
20 K A -1.9907 Soluble
21 V A 0.0000 Buried
22 S A -0.7357 Soluble
23 C A 0.0000 Buried
24 K A -1.5980 Soluble
25 A A -0.6688 Soluble
26 S A -0.6290 Soluble
27 G A -0.5257 Soluble
28 G A -0.1905 Soluble
29 P A 0.2212 Aggregation-prone
30 F A 1.5558 Aggregation-prone
35 R A 0.5069 Aggregation-prone
36 S A 0.7484 Aggregation-prone
37 Y A 0.8143 Aggregation-prone
38 A A 0.0000 Buried
39 I A 0.0000 Buried
40 S A 0.0000 Buried
41 W A 0.0000 Buried
42 V A 0.0000 Buried
43 R A -0.3259 Soluble
44 Q A 0.0000 Buried
45 A A -0.9212 Soluble
46 P A -0.8196 Soluble
47 G A -1.1941 Soluble
48 Q A -1.6797 Soluble
49 G A -1.1163 Soluble
50 P A 0.0000 Buried
51 E A -0.5277 Soluble
52 W A 0.0000 Buried
53 M A 0.0000 Buried
54 G A 0.0000 Buried
55 G A 0.0000 Buried
56 I A 0.0000 Buried
57 I A 0.0000 Buried
58 P A 1.4999 Aggregation-prone
59 I A 2.9756 Aggregation-prone
62 F A 2.8104 Aggregation-prone
63 G A 1.0990 Aggregation-prone
64 T A 0.3727 Aggregation-prone
65 T A -0.1969 Soluble
66 K A -0.6345 Soluble
67 Y A -0.6717 Soluble
68 A A 0.0000 Buried
69 P A -1.3575 Soluble
70 K A -2.1715 Soluble
71 F A 0.0000 Buried
72 Q A -2.0607 Soluble
74 G A -1.4484 Soluble
75 R A -1.1750 Soluble
76 V A 0.0000 Buried
77 T A -0.7274 Soluble
78 I A 0.0000 Buried
79 T A -0.4643 Soluble
80 A A -0.6892 Soluble
81 D A -0.9535 Soluble
82 D A -0.4145 Soluble
83 F A 1.2126 Aggregation-prone
84 A A 0.0986 Aggregation-prone
85 G A -0.5775 Soluble
86 T A 0.0000 Buried
87 V A 0.0000 Buried
88 Y A -0.6062 Soluble
89 M A 0.0000 Buried
90 E A -1.2297 Soluble
91 L A 0.0000 Buried
92 S A -1.0639 Soluble
93 S A -1.0560 Soluble
94 L A 0.0000 Buried
95 R A -3.0648 Soluble
96 S A -2.3950 Soluble
97 E A -2.5519 Soluble
98 D A 0.0000 Buried
99 T A -0.8223 Soluble
100 A A 0.0000 Buried
101 M A -0.0681 Soluble
102 Y A 0.0000 Buried
103 Y A 0.0000 Buried
104 C A 0.0000 Buried
105 A A 0.0000 Buried
106 K A 0.1588 Aggregation-prone
107 H A 0.0000 Buried
108 M A 0.4332 Aggregation-prone
109 G A 0.3103 Aggregation-prone
110 Y A 1.2271 Aggregation-prone
111 Q A -0.3437 Soluble
112A V A 0.0000 Buried
112 R A -0.2703 Soluble
113 E A 0.0000 Buried
114 T A 0.0000 Buried
115 M A 0.0000 Buried
116 D A -0.5643 Soluble
117 V A 0.0214 Aggregation-prone
118 W A 0.0000 Buried
119 G A -0.8893 Soluble
120 K A -1.7363 Soluble
121 G A -0.8952 Soluble
122 T A 0.0000 Buried
123 T A 0.0010 Aggregation-prone
124 V A 0.0000 Buried
125 T A -0.2529 Soluble
126 V A 0.0000 Buried
127 S A -1.1169 Soluble
3 V C 1.6369 Aggregation-prone
4 L C 0.0000 Buried
5 T C 0.0639 Aggregation-prone
6 Q C 0.0000 Buried
7 P C -0.6073 Soluble
8 P C -0.9368 Soluble
9 S C -1.0513 Soluble
11 V C -0.5200 Soluble
12 S C -0.0537 Soluble
13 A C -0.1143 Soluble
14 A C -0.2353 Soluble
15 P C -0.9539 Soluble
16 G C -1.5469 Soluble
17 Q C -2.1422 Soluble
18 K C -2.3849 Soluble
19 V C 0.0000 Buried
20 T C -0.4913 Soluble
21 I C 0.0000 Buried
22 S C -0.3187 Soluble
23 C C 0.0000 Buried
24 S C -0.2010 Soluble
25 G C 0.0884 Aggregation-prone
26 S C -0.2552 Soluble
27 S C -0.7828 Soluble
28 S C -0.8415 Soluble
29 N C 0.0000 Buried
30 I C 0.0000 Buried
35 G C -1.0874 Soluble
36 N C -1.4759 Soluble
37 D C -0.7012 Soluble
38 Y C -0.1027 Soluble
39 V C 0.0000 Buried
40 S C 0.0000 Buried
41 W C 0.0000 Buried
42 Y C 0.0000 Buried
43 Q C -0.6897 Soluble
44 Q C -0.6573 Soluble
45 L C -0.3998 Soluble
46 P C -0.5207 Soluble
47 G C -0.5055 Soluble
48 T C -0.7250 Soluble
49 A C 0.0000 Buried
50 P C 0.0000 Buried
51 K C -1.1080 Soluble
52 L C 0.0000 Buried
53 L C 0.0000 Buried
54 I C 0.0000 Buried
55 Y C -1.2816 Soluble
56 D C -1.6769 Soluble
57 N C -1.6013 Soluble
65 N C -2.5181 Soluble
66 K C -2.6905 Soluble
67 R C -2.1183 Soluble
68 P C -0.8822 Soluble
69 S C -0.5264 Soluble
70 G C -0.7155 Soluble
71 I C -0.6306 Soluble
72 P C -1.2361 Soluble
74 D C -2.2116 Soluble
75 R C -1.6561 Soluble
76 F C 0.0000 Buried
77 S C -1.4348 Soluble
78 G C -1.2574 Soluble
79 S C -1.2161 Soluble
80 K C -0.9599 Soluble
83 S C -0.7589 Soluble
84 G C -0.9437 Soluble
85 T C -0.8368 Soluble
86 S C -0.6263 Soluble
87 A C 0.0000 Buried
88 T C -0.5527 Soluble
89 L C 0.0000 Buried
90 G C -0.6765 Soluble
91 I C 0.0000 Buried
92 T C -1.8274 Soluble
93 G C -1.6583 Soluble
94 L C 0.0000 Buried
95 Q C -1.6251 Soluble
96 T C -0.9320 Soluble
97 G C -1.0635 Soluble
98 D C 0.0000 Buried
99 E C -1.5404 Soluble
100 A C -1.1354 Soluble
101 N C -1.2789 Soluble
102 Y C 0.0000 Buried
103 Y C 0.0000 Buried
104 C C 0.0000 Buried
105 A C 0.0000 Buried
106 T C 0.0000 Buried
107 W C -0.0190 Soluble
108 D C -0.6126 Soluble
109 R C -1.6017 Soluble
110 R C -2.2196 Soluble
112 P C -1.2628 Soluble
113 T C -0.8514 Soluble
114 A C -0.6876 Soluble
115 Y C -0.0068 Soluble
116 V C 0.0000 Buried
117 V C 0.5739 Aggregation-prone
118 F C 0.3825 Aggregation-prone
119 G C 0.0663 Aggregation-prone
120 G C -0.5707 Soluble
121 G C -1.1271 Soluble
122 T C 0.0000 Buried
123 K C -2.1014 Soluble
124 L C 0.0000 Buried
125 T C -0.3739 Soluble
126 V C 0.0677 Aggregation-prone
127 L C 1.3465 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.348 5.8368 CSV PDB
4.5 -0.3748 5.8368 CSV PDB
5.0 -0.4045 5.8368 CSV PDB
5.5 -0.4304 5.8368 CSV PDB
6.0 -0.4452 5.8368 CSV PDB
6.5 -0.4425 5.8368 CSV PDB
7.0 -0.4227 5.8368 CSV PDB
7.5 -0.3915 5.8368 CSV PDB
8.0 -0.3538 5.8368 CSV PDB
8.5 -0.3113 5.8367 CSV PDB
9.0 -0.264 5.8364 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH