Blontuvetmab / 9cq4

A4DAB051_9cq4_H_L | Source PDB: 9cq4 | Chains: H, L | Done
61.3
Yes
10 Å
Yes
Avg A4D Score
-0.688
Max Score
1.3879
Min Score
-3.6167
Total Score
-154.8
Score CDR
-0.6518
Score non-CDR
-0.6971

Calculation Parameters

Chain Sequence(s) QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSQIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAHFRGSGSGTSYSLTISGMEAEDAATYYCQQWSSNPFTFGSGTKLEIK input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.6167
Maximum Score 1.3879
Average Score -0.688
Total Score -154.8033

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q H -1.5564 Soluble
2 V H 0.0000 Buried
3 Q H -2.0861 Soluble
4 L H 0.0000 Buried
5 Q H -2.1724 Soluble
6 Q H 0.0000 Buried
7 S H -1.2125 Soluble
8 G H -1.0131 Soluble
9 A H -0.4952 Soluble
11 E H -0.9158 Soluble
12 L H 0.4481 Aggregation-prone
13 A H -0.6628 Soluble
14 R H -1.9040 Soluble
15 P H -1.4837 Soluble
16 G H -1.2072 Soluble
17 A H -1.0459 Soluble
18 S H -1.2143 Soluble
19 V H 0.0000 Buried
20 K H -2.1545 Soluble
21 M H 0.0000 Buried
22 S H -0.8194 Soluble
23 C H 0.0000 Buried
24 K H -1.6037 Soluble
25 A H 0.0000 Buried
26 S H -1.2221 Soluble
27 G H -1.0243 Soluble
28 Y H -0.7118 Soluble
29 T H -0.6307 Soluble
30 F H 0.0000 Buried
35 T H -1.5574 Soluble
36 R H -1.8176 Soluble
37 Y H -1.0591 Soluble
38 T H -0.4920 Soluble
39 M H 0.0000 Buried
40 H H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 K H 0.0000 Buried
44 Q H -0.6771 Soluble
45 R H -1.2163 Soluble
46 P H -1.1258 Soluble
47 G H -1.2683 Soluble
48 Q H -1.7168 Soluble
49 G H -1.0330 Soluble
50 L H 0.0000 Buried
51 E H -0.7512 Soluble
52 W H 0.0000 Buried
53 I H 0.0000 Buried
54 G H 0.0000 Buried
55 Y H 0.0754 Aggregation-prone
56 I H 0.0000 Buried
57 N H -0.7321 Soluble
58 P H 0.0000 Buried
59 S H -1.5655 Soluble
62 R H -1.7067 Soluble
63 G H -0.7841 Soluble
64 Y H 0.4186 Aggregation-prone
65 T H 0.0095 Aggregation-prone
66 N H -0.7246 Soluble
67 Y H -1.5879 Soluble
68 N H -2.4441 Soluble
69 Q H -3.1097 Soluble
70 K H -3.1546 Soluble
71 F H 0.0000 Buried
72 K H -3.6167 Soluble
74 D H -3.2108 Soluble
75 K H -2.3036 Soluble
76 A H 0.0000 Buried
77 T H -1.1255 Soluble
78 L H 0.0000 Buried
79 T H -0.1570 Soluble
80 T H -0.9437 Soluble
81 D H -1.7305 Soluble
82 K H -2.0019 Soluble
83 S H -1.2513 Soluble
84 S H -1.2169 Soluble
85 S H -1.3593 Soluble
86 T H 0.0000 Buried
87 A H 0.0000 Buried
88 Y H -0.5587 Soluble
89 M H 0.0000 Buried
90 Q H -1.4837 Soluble
91 L H 0.0000 Buried
92 S H -1.3334 Soluble
93 S H -1.0534 Soluble
94 L H 0.0000 Buried
95 T H -1.2328 Soluble
96 S H -1.2335 Soluble
97 E H -2.0203 Soluble
98 D H 0.0000 Buried
99 S H -0.8028 Soluble
100 A H 0.0000 Buried
101 V H -0.0546 Soluble
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 R H 0.0000 Buried
107 Y H 0.0000 Buried
108 Y H -1.1226 Soluble
109 D H -2.3373 Soluble
110 D H -2.5453 Soluble
112 H H -1.5791 Soluble
113 Y H -0.5385 Soluble
114 C H 0.0000 Buried
115 L H 0.0000 Buried
116 D H 0.0000 Buried
117 Y H -0.2596 Soluble
118 W H 0.0000 Buried
119 G H 0.0000 Buried
120 Q H -1.7341 Soluble
121 G H -0.8943 Soluble
122 T H 0.0000 Buried
123 T H -0.3806 Soluble
124 L H 0.0000 Buried
125 T H -0.2396 Soluble
126 V H 0.0000 Buried
127 S H -0.7219 Soluble
128 S H -0.8497 Soluble
1 Q L -1.2255 Soluble
2 I L 0.0000 Buried
3 V L 1.3098 Aggregation-prone
4 L L 0.0000 Buried
5 T L 0.2118 Aggregation-prone
6 Q L 0.0000 Buried
7 S L -0.0502 Soluble
8 P L 0.2348 Aggregation-prone
9 A L 0.5685 Aggregation-prone
10 I L 1.3879 Aggregation-prone
11 M L 0.4361 Aggregation-prone
12 S L -0.5815 Soluble
13 A L -1.3478 Soluble
14 S L -1.6999 Soluble
15 P L -2.0071 Soluble
16 G L -2.1553 Soluble
17 E L -3.1621 Soluble
18 K L -2.8336 Soluble
19 V L 0.0000 Buried
20 T L -0.8861 Soluble
21 M L 0.0000 Buried
22 T L -0.2308 Soluble
23 C L 0.0000 Buried
24 S L -0.1537 Soluble
25 A L 0.1233 Aggregation-prone
26 S L -0.0261 Soluble
27 S L -0.3509 Soluble
28 S L -0.5716 Soluble
29 V L 0.0000 Buried
37 S L -0.3746 Soluble
38 Y L -0.1678 Soluble
39 M L 0.0000 Buried
40 N L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L 0.0000 Buried
45 K L -1.4009 Soluble
46 S L -0.8218 Soluble
47 G L -0.9112 Soluble
48 T L -0.9000 Soluble
49 S L -0.8150 Soluble
50 P L 0.0000 Buried
51 K L -0.9241 Soluble
52 R L -0.4459 Soluble
53 W L -0.3630 Soluble
54 I L 0.0000 Buried
55 Y L -0.7009 Soluble
56 D L -1.0799 Soluble
57 T L -0.9879 Soluble
65 S L -1.5321 Soluble
66 K L -2.0553 Soluble
67 L L -0.8929 Soluble
68 A L -0.4761 Soluble
69 S L -0.4974 Soluble
70 G L -0.4299 Soluble
71 V L -0.0811 Soluble
72 P L -0.3662 Soluble
74 A L -0.4001 Soluble
75 H L -0.7201 Soluble
76 F L 0.0000 Buried
77 R L -2.2308 Soluble
78 G L 0.0000 Buried
79 S L -1.1159 Soluble
80 G L -0.5510 Soluble
83 S L -0.6337 Soluble
84 G L -0.6781 Soluble
85 T L -0.5710 Soluble
86 S L -0.5527 Soluble
87 Y L 0.0000 Buried
88 S L -0.5358 Soluble
89 L L 0.0000 Buried
90 T L -1.1720 Soluble
91 I L 0.0000 Buried
92 S L -1.7140 Soluble
93 G L -1.7929 Soluble
94 M L 0.0000 Buried
95 E L -1.7294 Soluble
96 A L -1.5496 Soluble
97 E L -2.1995 Soluble
98 D L 0.0000 Buried
99 A L -1.6443 Soluble
100 A L 0.0000 Buried
101 T L -0.7231 Soluble
102 Y L 0.0000 Buried
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 Q L 0.0000 Buried
106 Q L 0.0000 Buried
107 W L -0.0839 Soluble
108 S L -0.3370 Soluble
109 S L -1.0021 Soluble
114 N L -1.6462 Soluble
115 P L -1.0317 Soluble
116 F L 0.0000 Buried
117 T L -0.1304 Soluble
118 F L 0.0000 Buried
119 G L 0.0000 Buried
120 S L -0.3179 Soluble
121 G L -0.4097 Soluble
122 T L 0.0000 Buried
123 K L -0.9379 Soluble
124 L L 0.0000 Buried
125 E L -1.8226 Soluble
126 I L -1.0567 Soluble
127 K L -1.6780 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.8614 2.1438 CSV PDB
4.5 -0.8982 2.112 CSV PDB
5.0 -0.9415 2.0653 CSV PDB
5.5 -0.9817 2.0163 CSV PDB
6.0 -1.008 1.9842 CSV PDB
6.5 -1.013 1.9907 CSV PDB
7.0 -0.9972 2.0445 CSV PDB
7.5 -0.9678 2.1332 CSV PDB
8.0 -0.9313 2.2388 CSV PDB
8.5 -0.8897 2.3508 CSV PDB
9.0 -0.843 2.4643 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH