Anivovetmab / 3jcx

A4DAB019_3jcx_H_L | Source PDB: 3jcx | Chains: H, L | Done
98.19
Yes
10 Å
Yes
Avg A4D Score
-0.2889
Max Score
2.3833
Min Score
-3.078
Total Score
-64.13
Score CDR
-0.0079
Score non-CDR
-0.3685

Calculation Parameters

Chain Sequence(s) SGPGLVQPSQTLSLTCTVSGFSLSSYHVHWVRQPPGKGLEWLGVMWNDGDTSYNLALNSRLSISRDTSKSQVFFKMSSLQTEDTATYYCARPELPGLTYGVWFPYWGQGTLVTVSLMTQIPASMSISVGDRVTMNCKASQNVDSNVDWYQQKTGQSPNLLIYKASNRNTGVPDRFTGSGSGTDFTFTISNMQAEDLAVYYCMQSTSYPLTFGSGTKLEIKRA input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.078
Maximum Score 2.3833
Average Score -0.2889
Total Score -64.1303

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
7 S H -0.4085 Soluble
8 G H 0.0000 Buried
9 P H 0.4745 Aggregation-prone
11 G H 1.2349 Aggregation-prone
12 L H 2.2700 Aggregation-prone
13 V H 1.8380 Aggregation-prone
14 Q H -0.1584 Soluble
15 P H -0.1440 Soluble
16 S H -0.5738 Soluble
17 Q H -1.6729 Soluble
18 T H -0.9838 Soluble
19 L H 0.0000 Buried
20 S H -0.5207 Soluble
21 L H 0.3456 Aggregation-prone
22 T H 0.7598 Aggregation-prone
23 C H 0.9012 Aggregation-prone
24 T H 0.8931 Aggregation-prone
25 V H 1.7726 Aggregation-prone
26 S H 0.0000 Buried
27 G H 0.9495 Aggregation-prone
28 F H 1.2567 Aggregation-prone
29 S H 1.2255 Aggregation-prone
30 L H 0.8036 Aggregation-prone
35 S H 0.5402 Aggregation-prone
36 S H 0.0000 Buried
37 Y H 0.0000 Buried
38 H H 0.0000 Buried
39 V H 0.0000 Buried
40 H H 0.0687 Aggregation-prone
41 W H -0.1211 Soluble
42 V H -0.4422 Soluble
43 R H -0.9440 Soluble
44 Q H -0.8721 Soluble
45 P H -0.8265 Soluble
46 P H -0.8422 Soluble
47 G H -1.3881 Soluble
48 K H -1.8435 Soluble
49 G H -0.9742 Soluble
50 L H -0.2267 Soluble
51 E H -0.3654 Soluble
52 W H 0.0000 Buried
53 L H -0.2105 Soluble
54 G H -0.5780 Soluble
55 V H 0.3140 Aggregation-prone
56 M H 0.6703 Aggregation-prone
57 W H 0.6267 Aggregation-prone
58 N H -1.1519 Soluble
59 D H -1.7388 Soluble
63 G H -1.1496 Soluble
64 D H -1.1930 Soluble
65 T H 0.0240 Aggregation-prone
66 S H 0.2921 Aggregation-prone
67 Y H 0.8277 Aggregation-prone
68 N H 0.1069 Aggregation-prone
69 L H 1.6651 Aggregation-prone
70 A H 0.0000 Buried
71 L H 1.6140 Aggregation-prone
72 N H 0.2517 Aggregation-prone
74 S H 0.1822 Aggregation-prone
75 R H 0.1906 Aggregation-prone
76 L H 1.4536 Aggregation-prone
77 S H 1.3332 Aggregation-prone
78 I H 1.7227 Aggregation-prone
79 S H 0.0996 Aggregation-prone
80 R H -0.9761 Soluble
81 D H 0.2307 Aggregation-prone
82 T H -0.0688 Soluble
83 S H -0.8681 Soluble
84 K H -1.7424 Soluble
85 S H -1.2978 Soluble
86 Q H 0.0000 Buried
87 V H 0.0000 Buried
88 F H 0.5820 Aggregation-prone
89 F H 0.3640 Aggregation-prone
90 K H -0.7693 Soluble
91 M H 0.2592 Aggregation-prone
92 S H 0.1881 Aggregation-prone
93 S H 0.0141 Aggregation-prone
94 L H 1.4940 Aggregation-prone
95 Q H 0.4507 Aggregation-prone
96 T H 0.8565 Aggregation-prone
97 E H 0.2288 Aggregation-prone
98 D H 0.4995 Aggregation-prone
99 T H 0.0000 Buried
100 A H 0.0000 Buried
101 T H 0.1755 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 1.1928 Aggregation-prone
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 R H -0.7079 Soluble
107 P H 0.0000 Buried
108 E H 0.0319 Aggregation-prone
109 L H 0.3736 Aggregation-prone
110 P H 0.2765 Aggregation-prone
111 G H 0.5639 Aggregation-prone
111A L H 1.8557 Aggregation-prone
112B T H 1.2179 Aggregation-prone
112A Y H 1.6522 Aggregation-prone
112 G H 1.0236 Aggregation-prone
113 V H 0.0000 Buried
114 W H 0.2144 Aggregation-prone
115 F H 0.0000 Buried
116 P H 0.5292 Aggregation-prone
117 Y H 0.8480 Aggregation-prone
118 W H 0.3041 Aggregation-prone
119 G H -0.4434 Soluble
120 Q H -0.9837 Soluble
121 G H -0.7737 Soluble
122 T H 0.1637 Aggregation-prone
123 L H 1.2107 Aggregation-prone
124 V H 2.1830 Aggregation-prone
125 T H 1.6919 Aggregation-prone
126 V H 2.3833 Aggregation-prone
127 S H 1.8761 Aggregation-prone
3 L L 1.1184 Aggregation-prone
4 M L 0.1475 Aggregation-prone
5 T L 0.2456 Aggregation-prone
6 Q L 0.0000 Buried
7 I L 0.6975 Aggregation-prone
8 P L 0.2745 Aggregation-prone
9 A L -0.1783 Soluble
10 S L -0.7051 Soluble
11 M L -0.9474 Soluble
12 S L -1.5893 Soluble
13 I L -1.2031 Soluble
14 S L -0.8987 Soluble
15 V L 0.1615 Aggregation-prone
16 G L -1.0059 Soluble
17 D L -1.9124 Soluble
18 R L -2.3415 Soluble
19 V L -0.8741 Soluble
20 T L -0.4818 Soluble
21 M L 0.0000 Buried
22 N L -1.0851 Soluble
23 C L 0.0000 Buried
24 K L -2.0934 Soluble
25 A L -1.2818 Soluble
26 S L -1.2216 Soluble
27 Q L -2.0319 Soluble
28 N L -2.7043 Soluble
29 V L 0.0000 Buried
36 D L -2.4279 Soluble
37 S L -1.4368 Soluble
38 N L 0.0000 Buried
39 V L 0.0000 Buried
40 D L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L -1.2925 Soluble
45 K L -2.1016 Soluble
46 T L -1.4628 Soluble
47 G L -1.5988 Soluble
48 Q L -1.7966 Soluble
49 S L -1.1567 Soluble
50 P L 0.0000 Buried
51 N L 0.0000 Buried
52 L L 0.0000 Buried
53 L L -0.5555 Soluble
54 I L 0.0000 Buried
55 Y L -0.5336 Soluble
56 K L -0.5238 Soluble
57 A L -0.8476 Soluble
65 S L -1.2198 Soluble
66 N L -2.0116 Soluble
67 R L -2.9548 Soluble
68 N L -1.9852 Soluble
69 T L -0.7969 Soluble
70 G L -0.5896 Soluble
71 V L 0.3025 Aggregation-prone
72 P L -1.5520 Soluble
74 D L -2.7307 Soluble
75 R L -1.9537 Soluble
76 F L 0.0000 Buried
77 T L -1.4392 Soluble
78 G L 0.0000 Buried
79 S L -0.8485 Soluble
80 G L -1.1880 Soluble
83 S L -1.6303 Soluble
84 G L -2.2078 Soluble
85 T L -2.4939 Soluble
86 D L -3.0780 Soluble
87 F L 0.0000 Buried
88 T L -1.0735 Soluble
89 F L 0.0000 Buried
90 T L -0.6966 Soluble
91 I L 0.0000 Buried
92 S L -2.1325 Soluble
93 N L -2.5298 Soluble
94 M L 0.0000 Buried
95 Q L -1.3891 Soluble
96 A L -1.1090 Soluble
97 E L -2.4583 Soluble
98 D L 0.0000 Buried
99 L L -0.8923 Soluble
100 A L -0.7710 Soluble
101 V L -0.6625 Soluble
102 Y L 0.0000 Buried
103 Y L 0.0179 Aggregation-prone
104 C L 0.0000 Buried
105 M L 0.0000 Buried
106 Q L 0.0000 Buried
107 S L 0.0000 Buried
108 T L -0.0052 Soluble
109 S L 0.6533 Aggregation-prone
114 Y L 0.9447 Aggregation-prone
115 P L 0.2418 Aggregation-prone
116 L L 0.0297 Aggregation-prone
117 T L 0.2001 Aggregation-prone
118 F L 0.1567 Aggregation-prone
119 G L 0.0000 Buried
120 S L -0.1011 Soluble
121 G L -0.2448 Soluble
122 T L 0.0000 Buried
123 K L -1.7500 Soluble
124 L L 0.0000 Buried
125 E L -2.0994 Soluble
126 I L -1.4378 Soluble
127 K L -2.6067 Soluble
128 R L -2.8341 Soluble
129 A L -1.2412 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.2363 3.6674 CSV PDB
4.5 -0.2751 3.585 CSV PDB
5.0 -0.319 3.4901 CSV PDB
5.5 -0.3579 3.3902 CSV PDB
6.0 -0.3831 3.2887 CSV PDB
6.5 -0.3911 3.1868 CSV PDB
7.0 -0.3847 3.0851 CSV PDB
7.5 -0.3695 2.9848 CSV PDB
8.0 -0.3493 2.9452 CSV PDB
8.5 -0.3242 3.003 CSV PDB
9.0 -0.2922 3.0601 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH