Cosfroviximab / 5ken

A4DAB073_5ken_G_H | Source PDB: 5ken | Chains: G, H | Done
48.17
Yes
10 Å
Yes
Avg A4D Score
-0.6166
Max Score
1.7323
Min Score
-3.1277
Total Score
-138.74
Score CDR
-0.0065
Score non-CDR
-0.7734

Calculation Parameters

Chain Sequence(s) EVQLQESGPELEMPGASVKISCKASGSSFTGFSMNWVKQSNGKSLEWIGNIDTYYGGTTYNQKFKGKATLTVDKSSSTAYMQLKSLTSEDSAVYYCARSAYYGSTFAYWGQGTLVTVSDIQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYNAKTLIEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYFCQHHFGTPFTFGSGTELEIK input.pdb
Selected Chain(s) G (Heavy), H (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.1277
Maximum Score 1.7323
Average Score -0.6166
Total Score -138.7438

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E G -2.1928 Soluble
2 V G 0.0000 Buried
3 Q G -2.0223 Soluble
4 L G 0.0000 Buried
5 Q G -2.3114 Soluble
6 E G -1.6732 Soluble
7 S G -1.1981 Soluble
8 G G -1.3733 Soluble
9 P G -1.1024 Soluble
11 E G -1.3793 Soluble
12 L G 0.5172 Aggregation-prone
13 E G 0.0655 Aggregation-prone
14 M G 0.7407 Aggregation-prone
15 P G -0.1847 Soluble
16 G G -0.7127 Soluble
17 A G 0.0000 Buried
18 S G -0.9678 Soluble
19 V G -0.9942 Soluble
20 K G -1.7024 Soluble
21 I G 0.0000 Buried
22 S G -0.9422 Soluble
23 C G 0.0000 Buried
24 K G -2.1016 Soluble
25 A G 0.0000 Buried
26 S G -1.6606 Soluble
27 G G -1.2504 Soluble
28 S G -0.8436 Soluble
29 S G -0.7584 Soluble
30 F G 0.0000 Buried
35 T G -0.3766 Soluble
36 G G -0.3592 Soluble
37 F G 0.0000 Buried
38 S G -0.0277 Soluble
39 M G 0.0000 Buried
40 N G 0.0000 Buried
41 W G 0.0000 Buried
42 V G 0.0000 Buried
43 K G -0.6979 Soluble
44 Q G 0.0000 Buried
45 S G -1.7932 Soluble
46 N G -2.3912 Soluble
47 G G -2.1141 Soluble
48 K G -2.4883 Soluble
49 S G -1.4003 Soluble
50 L G 0.0000 Buried
51 E G -0.9624 Soluble
52 W G 0.0000 Buried
53 I G 0.0000 Buried
54 G G 0.0000 Buried
55 N G -0.3008 Soluble
56 I G 0.0000 Buried
57 D G 0.0657 Aggregation-prone
58 T G 0.0000 Buried
59 Y G 1.4748 Aggregation-prone
62 Y G 1.5277 Aggregation-prone
63 G G 0.4538 Aggregation-prone
64 G G 0.0285 Aggregation-prone
65 T G -0.1477 Soluble
66 T G -0.3779 Soluble
67 Y G -0.7593 Soluble
68 N G 0.0000 Buried
69 Q G -2.6879 Soluble
70 K G -3.1277 Soluble
71 F G -2.3658 Soluble
72 K G -3.1245 Soluble
74 G G -2.4190 Soluble
75 K G -2.5454 Soluble
76 A G 0.0000 Buried
77 T G -0.7295 Soluble
78 L G -0.2917 Soluble
79 T G -0.1774 Soluble
80 V G 0.0693 Aggregation-prone
81 D G -0.6996 Soluble
82 K G -0.8860 Soluble
83 S G -0.7497 Soluble
84 S G -0.8175 Soluble
85 S G -1.0339 Soluble
86 T G 0.0000 Buried
87 A G 0.0000 Buried
88 Y G -0.3243 Soluble
89 M G 0.0000 Buried
90 Q G -1.2049 Soluble
91 L G 0.0000 Buried
92 K G -1.9469 Soluble
93 S G -0.9493 Soluble
94 L G 0.0000 Buried
95 T G -1.2356 Soluble
96 S G -1.2083 Soluble
97 E G -2.4257 Soluble
98 D G -1.8495 Soluble
99 S G -1.2784 Soluble
100 A G 0.0000 Buried
101 V G -0.4014 Soluble
102 Y G 0.0000 Buried
103 Y G 0.0000 Buried
104 C G 0.0000 Buried
105 A G 0.0000 Buried
106 R G 0.0000 Buried
107 S G 0.0000 Buried
108 A G 0.0000 Buried
109 Y G 1.2879 Aggregation-prone
110 Y G 0.7372 Aggregation-prone
112 G G 0.0629 Aggregation-prone
113 S G 0.0962 Aggregation-prone
114 T G 0.1783 Aggregation-prone
115 F G 0.5748 Aggregation-prone
116 A G 0.0000 Buried
117 Y G 0.1532 Aggregation-prone
118 W G 0.0000 Buried
119 G G -1.4636 Soluble
120 Q G -1.4313 Soluble
121 G G -1.1072 Soluble
122 T G 0.0000 Buried
123 L G -0.2958 Soluble
124 V G 0.0000 Buried
125 T G -0.4201 Soluble
126 V G 0.0000 Buried
127 S G 0.2100 Aggregation-prone
1 D H -2.5555 Soluble
2 I H -1.6884 Soluble
3 Q H -2.1279 Soluble
4 M H -1.4645 Soluble
5 T H -0.8507 Soluble
6 Q H 0.0000 Buried
7 S H -0.4980 Soluble
8 P H -0.2717 Soluble
9 A H -0.2609 Soluble
10 S H -0.5509 Soluble
11 L H -0.2608 Soluble
12 S H -0.4028 Soluble
13 A H 0.0000 Buried
14 S H -0.2095 Soluble
15 V H 0.2894 Aggregation-prone
16 G H -0.5734 Soluble
17 E H -1.1132 Soluble
18 T H -1.1340 Soluble
19 V H 0.0000 Buried
20 T H -0.6534 Soluble
21 I H 0.0000 Buried
22 T H -0.6717 Soluble
23 C H 0.0000 Buried
24 R H -2.2230 Soluble
25 A H 0.0000 Buried
26 S H -2.2666 Soluble
27 E H -2.8766 Soluble
28 N H -1.6641 Soluble
29 I H 0.0000 Buried
36 Y H 0.9598 Aggregation-prone
37 S H 0.2596 Aggregation-prone
38 Y H 0.9641 Aggregation-prone
39 L H 0.0000 Buried
40 A H 0.0000 Buried
41 W H 0.0000 Buried
42 Y H 0.0000 Buried
43 Q H -1.0062 Soluble
44 Q H -1.9077 Soluble
45 K H -2.5779 Soluble
46 Q H -2.4666 Soluble
47 G H -2.2760 Soluble
48 K H -2.9350 Soluble
49 S H -1.6109 Soluble
50 P H 0.0000 Buried
51 Q H -0.8292 Soluble
52 L H 0.0000 Buried
53 L H 0.0000 Buried
54 V H 0.0000 Buried
55 Y H 0.0711 Aggregation-prone
56 N H -0.3711 Soluble
57 A H 0.0000 Buried
65 K H -1.8526 Soluble
66 T H -0.9357 Soluble
67 L H -0.4169 Soluble
68 I H -0.5032 Soluble
69 E H -1.7301 Soluble
70 G H -1.1396 Soluble
71 V H -0.5772 Soluble
72 P H -0.6202 Soluble
74 S H -0.5769 Soluble
75 R H -1.1233 Soluble
76 F H 0.0000 Buried
77 S H -1.1152 Soluble
78 G H -1.2036 Soluble
79 S H -1.2692 Soluble
80 G H -1.0198 Soluble
83 S H -0.7966 Soluble
84 G H 0.0000 Buried
85 T H -1.7950 Soluble
86 Q H -1.6351 Soluble
87 F H 0.0000 Buried
88 S H -0.9931 Soluble
89 L H 0.0000 Buried
90 K H -1.3909 Soluble
91 I H 0.0000 Buried
92 N H -1.9032 Soluble
93 S H -1.1582 Soluble
94 L H 0.0000 Buried
95 Q H -0.8351 Soluble
96 P H -0.7723 Soluble
97 E H -2.0188 Soluble
98 D H 0.0000 Buried
99 F H 0.0000 Buried
100 G H 0.0000 Buried
101 S H -1.3133 Soluble
102 Y H 0.0000 Buried
103 F H 0.0000 Buried
104 C H 0.0000 Buried
105 Q H 0.0000 Buried
106 H H 0.0000 Buried
107 H H 0.0000 Buried
108 F H 1.7323 Aggregation-prone
109 G H 0.6919 Aggregation-prone
114 T H 0.1065 Aggregation-prone
115 P H -0.6017 Soluble
116 F H 0.0000 Buried
117 T H -0.5239 Soluble
118 F H 0.0000 Buried
119 G H 0.0000 Buried
120 S H -0.8470 Soluble
121 G H -0.6829 Soluble
122 T H 0.0000 Buried
123 E H -1.0600 Soluble
124 L H 0.0000 Buried
125 E H -0.5462 Soluble
126 I H 0.8297 Aggregation-prone
127 K H -0.8710 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6253 3.6392 CSV PDB
4.5 -0.6645 3.6392 CSV PDB
5.0 -0.7125 3.6392 CSV PDB
5.5 -0.7576 3.6392 CSV PDB
6.0 -0.7862 3.6392 CSV PDB
6.5 -0.7864 3.6392 CSV PDB
7.0 -0.7576 3.6392 CSV PDB
7.5 -0.7097 3.6391 CSV PDB
8.0 -0.6526 3.6389 CSV PDB
8.5 -0.5908 3.6383 CSV PDB
9.0 -0.5262 3.6362 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH