Diridavumab / 8dim

A4DAB087_8dim_E_F | Source PDB: 8dim | Chains: E, F | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.457
Max Score
3.0029
Min Score
-2.5911
Total Score
-103.74
Score CDR
-0.1436
Score non-CDR
-0.5525

Calculation Parameters

Chain Sequence(s) VQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRRPTAYVVFGGGTKLTVL input.pdb
Selected Chain(s) E (Heavy), F (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.5911
Maximum Score 3.0029
Average Score -0.457
Total Score -103.7429

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V E 1.0330 Aggregation-prone
3 Q E -0.6794 Soluble
4 L E 0.0000 Buried
5 V E -0.7614 Soluble
6 E E -0.7354 Soluble
7 S E -0.8160 Soluble
8 G E -0.6272 Soluble
9 A E -0.0463 Soluble
11 E E 0.0740 Aggregation-prone
12 V E 1.1406 Aggregation-prone
13 K E -0.7042 Soluble
14 K E -1.8891 Soluble
15 P E -2.0035 Soluble
16 G E -1.5529 Soluble
17 S E -1.2441 Soluble
18 S E -1.3916 Soluble
19 V E 0.0000 Buried
20 K E -1.9644 Soluble
21 V E 0.0000 Buried
22 S E -0.6955 Soluble
23 C E 0.0000 Buried
24 K E -1.5410 Soluble
25 A E -0.6431 Soluble
26 S E -0.6495 Soluble
27 G E -0.5035 Soluble
28 G E -0.0043 Soluble
29 P E 0.3239 Aggregation-prone
30 F E 1.6935 Aggregation-prone
35 R E 0.6176 Aggregation-prone
36 S E 0.7773 Aggregation-prone
37 Y E 0.8266 Aggregation-prone
38 A E 0.0000 Buried
39 I E 0.0000 Buried
40 S E 0.0000 Buried
41 W E 0.0000 Buried
42 V E 0.0000 Buried
43 R E 0.0000 Buried
44 Q E -0.6360 Soluble
45 A E -1.0192 Soluble
46 P E -0.8593 Soluble
47 G E -1.2175 Soluble
48 Q E -1.7399 Soluble
49 G E -1.2150 Soluble
50 P E 0.0000 Buried
51 E E -0.9343 Soluble
52 W E 0.0000 Buried
53 M E 0.0000 Buried
54 G E 0.0000 Buried
55 G E 0.0000 Buried
56 I E 0.0000 Buried
57 I E 0.0000 Buried
58 P E 0.0000 Buried
59 I E 3.0029 Aggregation-prone
62 F E 2.8563 Aggregation-prone
63 G E 1.1056 Aggregation-prone
64 T E 0.3714 Aggregation-prone
65 T E -0.1707 Soluble
66 K E -0.7049 Soluble
67 Y E -0.7377 Soluble
68 A E 0.0000 Buried
69 P E -1.5740 Soluble
70 K E -2.3134 Soluble
71 F E 0.0000 Buried
72 Q E -2.1681 Soluble
74 G E -1.5388 Soluble
75 R E -1.3653 Soluble
76 V E 0.0000 Buried
77 T E -0.7631 Soluble
78 I E 0.0000 Buried
79 T E -0.2890 Soluble
80 A E -0.3182 Soluble
81 D E -0.4312 Soluble
82 D E -0.0801 Soluble
83 F E 1.4132 Aggregation-prone
84 A E 0.3167 Aggregation-prone
85 G E -0.2824 Soluble
86 T E 0.0000 Buried
87 V E 0.0000 Buried
88 Y E -0.3762 Soluble
89 M E 0.0000 Buried
90 E E -1.3349 Soluble
91 L E 0.0000 Buried
92 S E -1.0889 Soluble
93 S E -1.0032 Soluble
94 L E 0.0000 Buried
95 R E -2.5911 Soluble
96 S E -1.9106 Soluble
97 E E -2.2588 Soluble
98 D E 0.0000 Buried
99 T E -0.5767 Soluble
100 A E 0.0000 Buried
101 M E 0.0006 Aggregation-prone
102 Y E 0.0000 Buried
103 Y E 0.0000 Buried
104 C E 0.0000 Buried
105 A E 0.0000 Buried
106 K E 0.1167 Aggregation-prone
107 H E 0.0000 Buried
108 M E 0.3523 Aggregation-prone
109 G E 0.3373 Aggregation-prone
110 Y E 1.2356 Aggregation-prone
111 Q E -0.4213 Soluble
112A V E 0.0000 Buried
112 R E -0.3503 Soluble
113 E E 0.0000 Buried
114 T E 0.0000 Buried
115 M E 0.0000 Buried
116 D E -0.7445 Soluble
117 V E -0.0303 Soluble
118 W E -0.4392 Soluble
119 G E 0.0000 Buried
120 K E -1.7709 Soluble
121 G E -0.8347 Soluble
122 T E 0.0000 Buried
123 T E 0.0911 Aggregation-prone
124 V E 0.0000 Buried
125 T E 0.1352 Aggregation-prone
126 V E -0.2736 Soluble
3 V F 1.5490 Aggregation-prone
4 L F 0.0000 Buried
5 T F -0.0002 Soluble
6 Q F 0.0000 Buried
7 P F -0.4870 Soluble
8 P F -0.6388 Soluble
9 S F -0.6291 Soluble
11 V F -0.1268 Soluble
12 S F 0.0477 Aggregation-prone
13 A F -0.1287 Soluble
14 A F -0.2391 Soluble
15 P F -0.9288 Soluble
16 G F -1.7092 Soluble
17 Q F -2.2485 Soluble
18 K F -2.4243 Soluble
19 V F 0.0000 Buried
20 T F -0.4791 Soluble
21 I F 0.0000 Buried
22 S F -0.3547 Soluble
23 C F 0.0000 Buried
24 S F -0.2211 Soluble
25 G F -0.0156 Soluble
26 S F -0.3680 Soluble
27 S F -0.9011 Soluble
28 S F -1.1572 Soluble
29 N F 0.0000 Buried
30 I F 0.0000 Buried
35 G F -1.1088 Soluble
36 N F -1.5501 Soluble
37 D F -0.5923 Soluble
38 Y F 0.4921 Aggregation-prone
39 V F 0.0000 Buried
40 S F 0.0000 Buried
41 W F 0.0000 Buried
42 Y F 0.0000 Buried
43 Q F 0.0000 Buried
44 Q F -0.7170 Soluble
45 L F -0.3629 Soluble
46 P F -0.4706 Soluble
47 G F -0.7232 Soluble
48 T F -0.7409 Soluble
49 A F -0.6959 Soluble
50 P F 0.0000 Buried
51 K F -1.1557 Soluble
52 L F 0.0000 Buried
53 L F 0.0000 Buried
54 I F 0.0000 Buried
55 Y F -0.8612 Soluble
56 D F -0.8453 Soluble
57 N F -1.1376 Soluble
65 N F -2.2317 Soluble
66 K F -2.4345 Soluble
67 R F -2.2077 Soluble
68 P F -1.0116 Soluble
69 S F -0.7428 Soluble
70 G F -0.8403 Soluble
71 I F -0.9329 Soluble
72 P F -1.3011 Soluble
74 D F -2.2062 Soluble
75 R F -1.5780 Soluble
76 F F 0.0000 Buried
77 S F -1.3872 Soluble
78 G F -1.2233 Soluble
79 S F -1.2050 Soluble
80 K F -0.9904 Soluble
83 S F -0.7872 Soluble
84 G F -1.0327 Soluble
85 T F -0.9168 Soluble
86 S F -0.6695 Soluble
87 A F 0.0000 Buried
88 T F -0.5730 Soluble
89 L F 0.0000 Buried
90 G F -0.6505 Soluble
91 I F 0.0000 Buried
92 T F -1.8600 Soluble
93 G F -1.5881 Soluble
94 L F 0.0000 Buried
95 Q F -1.5247 Soluble
96 T F -0.7780 Soluble
97 G F -0.9860 Soluble
98 D F 0.0000 Buried
99 E F -1.0409 Soluble
100 A F 0.0000 Buried
101 N F -0.9433 Soluble
102 Y F 0.0000 Buried
103 Y F 0.0000 Buried
104 C F 0.0000 Buried
105 A F 0.0000 Buried
106 T F 0.0000 Buried
107 W F 0.0000 Buried
108 D F -1.0601 Soluble
109 R F -2.2770 Soluble
110 R F -2.5304 Soluble
112 P F -1.4482 Soluble
113 T F -1.0895 Soluble
114 A F -1.1465 Soluble
115 Y F -0.4188 Soluble
116 V F 0.0000 Buried
117 V F 0.0000 Buried
118 F F 0.0000 Buried
119 G F -0.0558 Soluble
120 G F -0.5118 Soluble
121 G F -0.9346 Soluble
122 T F 0.0000 Buried
123 K F -1.1769 Soluble
124 L F 0.0000 Buried
125 T F -0.0940 Soluble
126 V F 0.2013 Aggregation-prone
127 L F 1.3671 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.3307 5.8659 CSV PDB
4.5 -0.3488 5.7935 CSV PDB
5.0 -0.3706 5.7935 CSV PDB
5.5 -0.3903 5.7935 CSV PDB
6.0 -0.4002 5.7935 CSV PDB
6.5 -0.3937 5.7935 CSV PDB
7.0 -0.371 5.7935 CSV PDB
7.5 -0.3383 5.7935 CSV PDB
8.0 -0.3007 5.7935 CSV PDB
8.5 -0.2602 5.7934 CSV PDB
9.0 -0.2171 5.793 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH