Tixagevimab / 7mm0

A4DAB270_7mm0_H_L | Source PDB: 7mm0 | Chains: H, L | Done
95.26
Yes
10 Å
Yes
Avg A4D Score
-0.6849
Max Score
1.4237
Min Score
-3.2982
Total Score
-156.84
Score CDR
-0.3907
Score non-CDR
-0.7692

Calculation Parameters

Chain Sequence(s) MQLVQSGPEVKKPGTSVKVSCKASGFTFTSSAVQWVRQARGQRLEWIGWIVVGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAAPYCSGGSCFDGFDIWGQGTMVTVSSEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGFPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGNSPWTFGQGTKVEI input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.2982
Maximum Score 1.4237
Average Score -0.6849
Total Score -156.8354

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 M H 0.3141 Aggregation-prone
3 Q H -0.6409 Soluble
4 L H 0.0000 Buried
5 V H 0.5639 Aggregation-prone
6 Q H -0.1815 Soluble
7 S H -0.6333 Soluble
8 G H -0.3080 Soluble
9 P H -0.3396 Soluble
11 E H -0.3783 Soluble
12 V H 0.5347 Aggregation-prone
13 K H -1.2038 Soluble
14 K H -2.2639 Soluble
15 P H -1.9570 Soluble
16 G H -1.4411 Soluble
17 T H -1.0832 Soluble
18 S H -1.2661 Soluble
19 V H 0.0000 Buried
20 K H -1.8174 Soluble
21 V H 0.0000 Buried
22 S H -0.6111 Soluble
23 C H 0.0000 Buried
24 K H -1.4169 Soluble
25 A H 0.0000 Buried
26 S H -0.6353 Soluble
27 G H -0.2922 Soluble
28 F H 0.0277 Aggregation-prone
29 T H -0.2365 Soluble
30 F H 0.0000 Buried
35 T H -0.2663 Soluble
36 S H -0.4751 Soluble
37 S H -0.0213 Soluble
38 A H 0.1803 Aggregation-prone
39 V H 0.0000 Buried
40 Q H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H -1.0895 Soluble
44 Q H 0.0000 Buried
45 A H -2.0129 Soluble
46 R H -2.7182 Soluble
47 G H -2.3271 Soluble
48 Q H -2.9824 Soluble
49 R H -2.9610 Soluble
50 L H -1.5803 Soluble
51 E H -1.7707 Soluble
52 W H 0.0000 Buried
53 I H 0.0000 Buried
54 G H 0.0000 Buried
55 W H -0.0394 Soluble
56 I H 0.0000 Buried
57 V H -0.1766 Soluble
58 V H 0.0000 Buried
59 G H -0.5551 Soluble
62 S H -0.8068 Soluble
63 G H -1.0565 Soluble
64 N H -1.4991 Soluble
65 T H -0.9258 Soluble
66 N H -1.3435 Soluble
67 Y H -1.3974 Soluble
68 A H 0.0000 Buried
69 Q H -2.5677 Soluble
70 K H -2.9548 Soluble
71 F H -2.2994 Soluble
72 Q H -2.9483 Soluble
74 E H -3.0123 Soluble
75 R H -1.9918 Soluble
76 V H 0.0000 Buried
77 T H -0.9089 Soluble
78 I H -0.6583 Soluble
79 T H -0.6920 Soluble
80 R H -0.8304 Soluble
81 D H -0.8524 Soluble
82 M H -0.1583 Soluble
83 S H -0.3316 Soluble
84 T H -0.5490 Soluble
85 S H -0.7638 Soluble
86 T H 0.0000 Buried
87 A H 0.0000 Buried
88 Y H -0.7402 Soluble
89 M H -0.8765 Soluble
90 E H -1.6805 Soluble
91 L H -1.3515 Soluble
92 S H -1.2749 Soluble
93 S H -1.1192 Soluble
94 L H 0.0000 Buried
95 R H -2.4136 Soluble
96 S H -2.1476 Soluble
97 E H -2.4904 Soluble
98 D H -1.6592 Soluble
99 T H -0.9110 Soluble
100 A H 0.0000 Buried
101 V H -0.1750 Soluble
102 Y H -0.1581 Soluble
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 A H 0.0000 Buried
107 P H 0.0000 Buried
108 Y H 0.5679 Aggregation-prone
109 C H 0.0000 Buried
110 S H -0.3583 Soluble
111 G H -0.7916 Soluble
111A G H -0.7995 Soluble
112B S H -0.4819 Soluble
112A C H -0.0108 Soluble
112 F H -0.2713 Soluble
113 D H -1.3032 Soluble
114 G H 0.0000 Buried
115 F H 0.0000 Buried
116 D H -1.0774 Soluble
117 I H 0.0000 Buried
118 W H -0.4692 Soluble
119 G H 0.0000 Buried
120 Q H -1.1105 Soluble
121 G H -0.5211 Soluble
122 T H 0.0000 Buried
123 M H 0.1386 Aggregation-prone
124 V H 0.0000 Buried
125 T H -0.4136 Soluble
126 V H 0.0000 Buried
127 S H -0.8251 Soluble
128 S H -0.6839 Soluble
1 E L -0.8969 Soluble
2 I L 1.3641 Aggregation-prone
3 V L 1.2571 Aggregation-prone
4 L L 0.0000 Buried
5 T L 0.0386 Aggregation-prone
6 Q L 0.0000 Buried
7 S L -0.7159 Soluble
8 P L -0.6443 Soluble
9 G L -0.9690 Soluble
10 T L -0.8737 Soluble
11 L L -0.2352 Soluble
12 S L 0.2533 Aggregation-prone
13 L L 0.7447 Aggregation-prone
14 S L -0.1274 Soluble
15 P L -1.1521 Soluble
16 G L -1.6995 Soluble
17 E L 0.0000 Buried
18 R L -2.4471 Soluble
19 A L -1.1678 Soluble
20 T L -0.5661 Soluble
21 L L 0.0000 Buried
22 S L -0.8567 Soluble
23 C L 0.0000 Buried
24 R L -1.8497 Soluble
25 A L 0.0000 Buried
26 S L -0.9279 Soluble
27 Q L -1.6593 Soluble
28 S L -1.2272 Soluble
29 V L -0.5892 Soluble
30 S L -0.2026 Soluble
36 S L 0.0392 Aggregation-prone
37 S L 0.0253 Aggregation-prone
38 Y L 0.6039 Aggregation-prone
39 L L 0.0000 Buried
40 A L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L -1.0456 Soluble
45 K L -1.3842 Soluble
46 P L -1.0729 Soluble
47 G L -1.6820 Soluble
48 Q L -2.1626 Soluble
49 A L 0.0000 Buried
50 P L 0.0000 Buried
51 R L -2.1612 Soluble
52 L L 0.0000 Buried
53 L L 0.0000 Buried
54 I L 0.0000 Buried
55 Y L -0.1515 Soluble
56 G L 0.0000 Buried
57 A L 0.0000 Buried
65 S L -0.3285 Soluble
66 S L -0.4591 Soluble
67 R L -0.7151 Soluble
68 A L -0.4296 Soluble
69 T L -0.2460 Soluble
70 G L -0.4588 Soluble
71 F L -0.3899 Soluble
72 P L -1.2321 Soluble
74 D L -2.6902 Soluble
75 R L -2.7637 Soluble
76 F L 0.0000 Buried
77 S L -0.9845 Soluble
78 G L -0.4019 Soluble
79 S L -0.5874 Soluble
80 G L -0.9055 Soluble
83 S L -0.9514 Soluble
84 G L -1.1481 Soluble
85 T L -1.5535 Soluble
86 D L -1.8870 Soluble
87 F L 0.0000 Buried
88 T L -0.8267 Soluble
89 L L 0.0000 Buried
90 T L -0.7045 Soluble
91 I L 0.0000 Buried
92 S L -2.5048 Soluble
93 R L -3.2982 Soluble
94 L L 0.0000 Buried
95 E L -2.4230 Soluble
96 P L -1.6274 Soluble
97 E L -2.2640 Soluble
98 D L -1.3123 Soluble
99 F L -0.8492 Soluble
100 A L -0.8120 Soluble
101 V L -0.4140 Soluble
102 Y L 0.0000 Buried
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 Q L 0.0000 Buried
106 Q L -0.2109 Soluble
107 Y L 0.0000 Buried
108 G L -0.8462 Soluble
109 N L -1.6361 Soluble
114 S L -1.0352 Soluble
115 P L -1.0840 Soluble
116 W L -0.7719 Soluble
117 T L -0.3729 Soluble
118 F L 0.0000 Buried
119 G L -0.2726 Soluble
120 Q L -0.6027 Soluble
121 G L -0.9086 Soluble
122 T L 0.0000 Buried
123 K L -1.8643 Soluble
124 V L -0.7247 Soluble
125 E L -0.6012 Soluble
126 I L 1.4237 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.7104 2.5756 CSV PDB
4.5 -0.7548 2.4516 CSV PDB
5.0 -0.8094 2.2856 CSV PDB
5.5 -0.8636 2.1055 CSV PDB
6.0 -0.9073 1.9389 CSV PDB
6.5 -0.9328 1.8139 CSV PDB
7.0 -0.9379 1.7439 CSV PDB
7.5 -0.9283 1.7144 CSV PDB
8.0 -0.9108 1.7039 CSV PDB
8.5 -0.8881 1.7005 CSV PDB
9.0 -0.8606 1.6994 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH