Diridavumab / 8diu

A4DAB087_8diu_E_F | Source PDB: 8diu | Chains: E, F | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.491
Max Score
3.0005
Min Score
-3.0622
Total Score
-111.94
Score CDR
-0.2662
Score non-CDR
-0.559

Calculation Parameters

Chain Sequence(s) VQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVYMELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRRPTAYVVFGGGTKLTVL input.pdb
Selected Chain(s) E (Heavy), F (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.0622
Maximum Score 3.0005
Average Score -0.491
Total Score -111.9435

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V E 1.1196 Aggregation-prone
3 Q E -0.3034 Soluble
4 L E 0.0000 Buried
5 V E 0.5739 Aggregation-prone
6 E E -0.0949 Soluble
7 S E -0.4696 Soluble
8 G E -0.5240 Soluble
9 A E -0.1777 Soluble
11 E E -0.2582 Soluble
12 V E 0.8101 Aggregation-prone
13 K E -0.9469 Soluble
14 K E -2.0976 Soluble
15 P E -2.0263 Soluble
16 G E -1.6479 Soluble
17 S E -1.2471 Soluble
18 S E -1.4122 Soluble
19 V E 0.0000 Buried
20 K E -2.1318 Soluble
21 V E 0.0000 Buried
22 S E -0.5330 Soluble
23 C E 0.0000 Buried
24 K E -0.7918 Soluble
25 A E -0.1750 Soluble
26 S E -0.2992 Soluble
27 G E -0.4163 Soluble
28 G E -0.1704 Soluble
29 P E 0.2621 Aggregation-prone
30 F E 1.6134 Aggregation-prone
35 R E 0.6318 Aggregation-prone
36 S E 0.7430 Aggregation-prone
37 Y E 0.8862 Aggregation-prone
38 A E 0.0000 Buried
39 I E 0.0000 Buried
40 S E 0.0000 Buried
41 W E 0.0000 Buried
42 V E 0.0000 Buried
43 R E 0.0000 Buried
44 Q E -0.5734 Soluble
45 A E -0.8564 Soluble
46 P E -0.8437 Soluble
47 G E -1.2037 Soluble
48 Q E -1.6846 Soluble
49 G E -1.0855 Soluble
50 P E 0.0000 Buried
51 E E -0.5378 Soluble
52 W E 0.0000 Buried
53 M E 0.0000 Buried
54 G E 0.0000 Buried
55 G E 0.0000 Buried
56 I E 0.0000 Buried
57 I E 0.0000 Buried
58 P E 0.0000 Buried
59 I E 3.0005 Aggregation-prone
62 F E 2.8080 Aggregation-prone
63 G E 1.1141 Aggregation-prone
64 T E 0.4702 Aggregation-prone
65 T E -0.1672 Soluble
66 K E -0.6339 Soluble
67 Y E -0.7767 Soluble
68 A E 0.0000 Buried
69 P E -1.5542 Soluble
70 K E -2.2863 Soluble
71 F E 0.0000 Buried
72 Q E -2.1927 Soluble
74 G E -1.5446 Soluble
75 R E -1.4251 Soluble
76 V E 0.0000 Buried
77 T E -0.9013 Soluble
78 I E 0.0000 Buried
79 T E -0.6254 Soluble
80 A E -0.9155 Soluble
81 D E -1.4672 Soluble
82 D E -0.5073 Soluble
83 F E 1.1739 Aggregation-prone
84 A E 0.1177 Aggregation-prone
85 G E -0.4897 Soluble
86 T E 0.0000 Buried
87 V E 0.0000 Buried
88 Y E -0.7346 Soluble
89 M E 0.0000 Buried
90 E E -1.6408 Soluble
91 L E 0.0000 Buried
92 S E -1.2122 Soluble
93 S E -1.0937 Soluble
94 L E 0.0000 Buried
95 R E -2.9087 Soluble
96 S E -2.1935 Soluble
97 E E -2.0118 Soluble
98 D E 0.0000 Buried
99 T E -0.6948 Soluble
100 A E 0.0000 Buried
101 M E -0.0195 Soluble
102 Y E 0.0000 Buried
103 Y E 0.0000 Buried
104 C E 0.0000 Buried
105 A E 0.0000 Buried
106 K E 0.1656 Aggregation-prone
107 H E 0.0000 Buried
108 M E 0.3988 Aggregation-prone
109 G E 0.3201 Aggregation-prone
110 Y E 1.2434 Aggregation-prone
111 Q E -0.1537 Soluble
112A V E 0.0000 Buried
112 R E -1.0813 Soluble
113 E E 0.0000 Buried
114 T E 0.0000 Buried
115 M E 0.0000 Buried
116 D E -0.5457 Soluble
117 V E 0.0686 Aggregation-prone
118 W E -0.2789 Soluble
119 G E -0.6882 Soluble
120 K E -1.5299 Soluble
121 G E 0.0000 Buried
122 T E 0.0000 Buried
123 T E 0.0557 Aggregation-prone
124 V E 0.0000 Buried
125 T E -0.1448 Soluble
126 V E 0.0000 Buried
127 S E -0.9720 Soluble
3 V F 1.5517 Aggregation-prone
4 L F 0.0000 Buried
5 T F 0.0190 Aggregation-prone
6 Q F 0.0000 Buried
7 P F -0.4509 Soluble
8 P F -0.6707 Soluble
9 S F -0.6147 Soluble
11 V F -0.1343 Soluble
12 S F 0.0597 Aggregation-prone
13 A F -0.1371 Soluble
14 A F -0.3505 Soluble
15 P F -0.9811 Soluble
16 G F -1.6700 Soluble
17 Q F -2.0807 Soluble
18 K F -2.2474 Soluble
19 V F -0.8964 Soluble
20 T F -0.3410 Soluble
21 I F 0.0000 Buried
22 S F -0.2988 Soluble
23 C F 0.0000 Buried
24 S F -0.2500 Soluble
25 G F -0.0276 Soluble
26 S F -0.4238 Soluble
27 S F -0.9488 Soluble
28 S F -1.3480 Soluble
29 N F 0.0000 Buried
30 I F 0.0000 Buried
35 G F -1.2050 Soluble
36 N F -1.7626 Soluble
37 D F -1.0544 Soluble
38 Y F -0.2257 Soluble
39 V F 0.0000 Buried
40 S F 0.0000 Buried
41 W F 0.0000 Buried
42 Y F 0.0000 Buried
43 Q F 0.0000 Buried
44 Q F -0.7399 Soluble
45 L F -0.4371 Soluble
46 P F -0.4966 Soluble
47 G F -0.7533 Soluble
48 T F -0.7854 Soluble
49 A F -0.7746 Soluble
50 P F 0.0000 Buried
51 K F -1.1877 Soluble
52 L F 0.0000 Buried
53 L F 0.0000 Buried
54 I F 0.0000 Buried
55 Y F -1.3010 Soluble
56 D F -1.7620 Soluble
57 N F -1.6547 Soluble
65 N F -2.5694 Soluble
66 K F -2.7632 Soluble
67 R F -2.1342 Soluble
68 P F -0.9177 Soluble
69 S F -0.5506 Soluble
70 G F -0.7903 Soluble
71 I F -1.0168 Soluble
72 P F -1.2543 Soluble
74 D F -2.1641 Soluble
75 R F -1.5617 Soluble
76 F F 0.0000 Buried
77 S F -1.4005 Soluble
78 G F -1.3580 Soluble
79 S F -1.3898 Soluble
80 K F -1.1018 Soluble
83 S F -0.7897 Soluble
84 G F -0.9993 Soluble
85 T F -0.9214 Soluble
86 S F -0.6670 Soluble
87 A F 0.0000 Buried
88 T F -0.5539 Soluble
89 L F 0.0000 Buried
90 G F 0.0000 Buried
91 I F 0.0000 Buried
92 T F -1.8016 Soluble
93 G F -1.7436 Soluble
94 L F 0.0000 Buried
95 Q F -1.7033 Soluble
96 T F -0.8044 Soluble
97 G F -0.9834 Soluble
98 D F 0.0000 Buried
99 E F -0.9774 Soluble
100 A F 0.0000 Buried
101 N F -0.9056 Soluble
102 Y F 0.0000 Buried
103 Y F 0.0000 Buried
104 C F 0.0000 Buried
105 A F 0.0000 Buried
106 T F 0.0000 Buried
107 W F 0.0000 Buried
108 D F -1.5796 Soluble
109 R F -3.0622 Soluble
110 R F -2.8981 Soluble
112 P F -1.6222 Soluble
113 T F -1.2605 Soluble
114 A F -1.6187 Soluble
115 Y F -0.7296 Soluble
116 V F 0.0000 Buried
117 V F 0.0000 Buried
118 F F 0.0000 Buried
119 G F 0.0000 Buried
120 G F -0.4777 Soluble
121 G F -0.8707 Soluble
122 T F 0.0000 Buried
123 K F -1.1462 Soluble
124 L F 0.0000 Buried
125 T F -0.0319 Soluble
126 V F 0.3765 Aggregation-prone
127 L F 1.5047 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.3779 5.8766 CSV PDB
4.5 -0.4043 5.7699 CSV PDB
5.0 -0.4338 5.7699 CSV PDB
5.5 -0.4604 5.7699 CSV PDB
6.0 -0.4771 5.7699 CSV PDB
6.5 -0.4774 5.7699 CSV PDB
7.0 -0.4615 5.7699 CSV PDB
7.5 -0.4352 5.7699 CSV PDB
8.0 -0.4034 5.7699 CSV PDB
8.5 -0.3671 5.7698 CSV PDB
9.0 -0.3258 5.7696 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH