Elipovimab / 7uoj

A4DAB100_7uoj_h_l | Source PDB: 7uoj | Chains: h, l | Done
96.61
Yes
10 Å
Yes
Avg A4D Score
-0.6173
Max Score
3.1752
Min Score
-2.8386
Total Score
-146.31
Score CDR
-0.2808
Score non-CDR
-0.7366

Calculation Parameters

Chain Sequence(s) QMQLQESGPGLVKPSETLSLTCSVSGASISDSYWSWIRRSPGKGLEWIGYVHKSGDTNYSPSLKSRVNLSLDTSKNQVSLSLVAATAADSGKYYCARTLHGRRIYGIVAFNEWFTYFYMDVWGNGTQVTVSSADISVAPGETARISCGEKSLGSRAVQWYQHRAGQAPSLIIYNNQDRPSGIPERFSGSPDSPFGTTATLTITSVEAGDEADYYCHIWDSRVPTKWVFGGGTTLTVL input.pdb
Selected Chain(s) h (Heavy), l (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.8386
Maximum Score 3.1752
Average Score -0.6173
Total Score -146.3118

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q h -1.4439 Soluble
2 M h -1.2898 Soluble
3 Q h -2.0310 Soluble
4 L h 0.0000 Buried
5 Q h -2.0338 Soluble
6 E h -1.5604 Soluble
7 S h -1.0154 Soluble
8 G h -0.6008 Soluble
9 P h -0.1419 Soluble
11 G h 0.0846 Aggregation-prone
12 L h 0.8676 Aggregation-prone
13 V h -0.4303 Soluble
14 K h -1.8888 Soluble
15 P h -1.3655 Soluble
16 S h -1.1970 Soluble
17 E h -1.7550 Soluble
18 T h -0.8669 Soluble
19 L h 0.0000 Buried
20 S h -0.2822 Soluble
21 L h 0.0000 Buried
22 T h -0.5894 Soluble
23 C h 0.0000 Buried
24 S h -1.4951 Soluble
25 V h 0.0000 Buried
26 S h -1.4441 Soluble
27 G h -1.3008 Soluble
28 A h -1.0338 Soluble
29 S h -1.1529 Soluble
30 I h 0.0000 Buried
35 S h -1.7114 Soluble
36 D h -2.1813 Soluble
37 S h -1.4422 Soluble
38 Y h -1.0481 Soluble
39 W h 0.0000 Buried
40 S h 0.0000 Buried
41 W h 0.0000 Buried
42 I h 0.0000 Buried
43 R h 0.0000 Buried
44 R h -1.6975 Soluble
45 S h 0.0000 Buried
46 P h -1.2771 Soluble
47 G h -1.5498 Soluble
48 K h -2.3310 Soluble
49 G h -1.4884 Soluble
50 L h 0.0000 Buried
51 E h -0.6117 Soluble
52 W h 0.0000 Buried
53 I h 0.0646 Aggregation-prone
54 G h 0.0000 Buried
55 Y h 0.0000 Buried
56 V h 0.0000 Buried
57 H h -1.8574 Soluble
58 K h -2.6060 Soluble
59 S h -1.7360 Soluble
63 G h -1.9262 Soluble
64 D h -2.4470 Soluble
65 T h -1.6787 Soluble
66 N h -1.1794 Soluble
67 Y h -1.0253 Soluble
68 S h -0.4763 Soluble
69 P h -0.6590 Soluble
70 S h -0.7154 Soluble
71 L h -1.0984 Soluble
72 K h -2.0008 Soluble
74 S h -1.6454 Soluble
75 R h -2.0351 Soluble
76 V h 0.0000 Buried
77 N h -1.6921 Soluble
78 L h 0.0000 Buried
79 S h -0.8859 Soluble
80 L h -1.1925 Soluble
81 D h -1.7005 Soluble
82 T h -1.4182 Soluble
83 S h -1.5321 Soluble
84 K h -2.5411 Soluble
85 N h -2.0942 Soluble
86 Q h -1.7181 Soluble
87 V h 0.0000 Buried
88 S h -0.5976 Soluble
89 L h 0.0000 Buried
90 S h -0.7303 Soluble
91 L h 0.0000 Buried
92 V h -0.4416 Soluble
93 A h -0.8431 Soluble
94 A h 0.0000 Buried
95 T h -0.5825 Soluble
96 A h -0.3736 Soluble
97 A h -0.1118 Soluble
98 D h -0.4051 Soluble
99 S h -0.4578 Soluble
100 G h -0.9547 Soluble
101 K h -1.2652 Soluble
102 Y h 0.0000 Buried
103 Y h 0.0000 Buried
104 C h 0.0000 Buried
105 A h 0.0000 Buried
106 R h -0.3746 Soluble
107 T h 0.0000 Buried
108 L h -0.6570 Soluble
109 H h -1.2247 Soluble
110 G h 0.0000 Buried
111 R h -1.9695 Soluble
111A R h -0.7466 Soluble
111B I h 1.3541 Aggregation-prone
111C Y h 1.7929 Aggregation-prone
111D G h 1.6708 Aggregation-prone
111E I h 3.1752 Aggregation-prone
111F V h 3.0590 Aggregation-prone
112G A h 1.8871 Aggregation-prone
112F F h 2.2241 Aggregation-prone
112E N h 0.5965 Aggregation-prone
112D E h 0.3948 Aggregation-prone
112C W h 0.7883 Aggregation-prone
112B F h -0.1455 Soluble
112A T h -0.5648 Soluble
112 Y h 0.0000 Buried
113 F h 0.0000 Buried
114 Y h 0.0341 Aggregation-prone
115 M h 0.0000 Buried
116 D h -0.3063 Soluble
117 V h -0.2721 Soluble
118 W h 0.0000 Buried
119 G h 0.0000 Buried
120 N h -1.8926 Soluble
121 G h -1.4609 Soluble
122 T h -1.3598 Soluble
123 Q h -1.4749 Soluble
124 V h 0.0000 Buried
125 T h -0.0950 Soluble
126 V h 0.0000 Buried
127 S h -0.3334 Soluble
128 S h -0.4926 Soluble
129 A h -0.1377 Soluble
10 D l -1.6663 Soluble
11 I l -0.5160 Soluble
12 S l 0.0522 Aggregation-prone
13 V l 0.0000 Buried
14 A l -0.2845 Soluble
15 P l -1.0035 Soluble
16 G l -1.7817 Soluble
17 E l -2.2337 Soluble
18 T l -1.5208 Soluble
19 A l 0.0000 Buried
20 R l -1.8763 Soluble
21 I l 0.0000 Buried
22 S l -1.2438 Soluble
23 C l 0.0000 Buried
24 G l -2.0785 Soluble
25 E l -2.8386 Soluble
26 K l -2.5791 Soluble
27 S l -0.8758 Soluble
28 L l 0.5410 Aggregation-prone
29 G l 0.0380 Aggregation-prone
36 S l 0.2342 Aggregation-prone
37 R l 0.0000 Buried
38 A l 0.0000 Buried
39 V l 0.0000 Buried
40 Q l 0.0000 Buried
41 W l 0.0000 Buried
42 Y l 0.0000 Buried
43 Q l -0.6366 Soluble
44 H l -0.9754 Soluble
45 R l -1.4304 Soluble
46 A l -0.9699 Soluble
47 G l -1.3148 Soluble
48 Q l -1.8223 Soluble
49 A l -1.1826 Soluble
50 P l 0.0000 Buried
51 S l -0.3395 Soluble
52 L l 0.0042 Aggregation-prone
53 I l 0.0000 Buried
54 I l 0.0000 Buried
55 Y l -0.4923 Soluble
56 N l 0.0000 Buried
57 N l -1.4275 Soluble
65 Q l -2.3050 Soluble
66 D l -2.6401 Soluble
67 R l -1.9839 Soluble
68 P l -1.0584 Soluble
69 S l -0.9551 Soluble
70 G l -0.7831 Soluble
71 I l -0.6706 Soluble
72 P l -1.2981 Soluble
74 E l -2.2159 Soluble
75 R l -1.5335 Soluble
76 F l 0.0000 Buried
77 S l -1.2837 Soluble
78 G l -0.9739 Soluble
79 S l -0.5082 Soluble
80 P l -0.7752 Soluble
81 D l -0.4118 Soluble
82 S l -0.1674 Soluble
82A P l 0.3411 Aggregation-prone
83 F l 1.6002 Aggregation-prone
84 G l 0.2564 Aggregation-prone
85 T l -0.1166 Soluble
86 T l -0.6879 Soluble
87 A l 0.0000 Buried
88 T l -0.7223 Soluble
89 L l 0.0000 Buried
90 T l -0.9172 Soluble
91 I l 0.0000 Buried
92 T l -1.4327 Soluble
93 S l -1.3969 Soluble
94 V l 0.0000 Buried
95 E l -2.2883 Soluble
96 A l -1.0153 Soluble
97 G l -1.3215 Soluble
98 D l 0.0000 Buried
99 E l -1.1955 Soluble
100 A l 0.0000 Buried
101 D l -1.0253 Soluble
102 Y l 0.0000 Buried
103 Y l -0.3343 Soluble
104 C l 0.0000 Buried
105 H l 0.0000 Buried
106 I l 0.0000 Buried
107 W l 0.0000 Buried
108 D l -0.6659 Soluble
109 S l -0.5493 Soluble
110 R l -1.2529 Soluble
112 V l 0.0044 Aggregation-prone
113 P l -0.4660 Soluble
114 T l -0.3152 Soluble
115 K l -0.1508 Soluble
116 W l 0.3567 Aggregation-prone
117 V l 0.8308 Aggregation-prone
118 F l 0.0000 Buried
119 G l -0.7801 Soluble
120 G l -1.1671 Soluble
121 G l -1.2793 Soluble
122 T l -0.8247 Soluble
123 T l -0.9801 Soluble
124 L l 0.0000 Buried
125 T l -0.3998 Soluble
126 V l 0.3760 Aggregation-prone
127 L l 1.3878 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.3829 5.4934 CSV PDB
4.5 -0.4279 5.4512 CSV PDB
5.0 -0.4831 5.3895 CSV PDB
5.5 -0.5385 5.3187 CSV PDB
6.0 -0.5839 5.2496 CSV PDB
6.5 -0.6119 5.1937 CSV PDB
7.0 -0.6213 5.1591 CSV PDB
7.5 -0.6174 5.1433 CSV PDB
8.0 -0.6057 5.1374 CSV PDB
8.5 -0.5876 5.1355 CSV PDB
9.0 -0.5631 5.1348 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH