Teropavimab / 5v8m

A4DAB261_5v8m_S_U | Source PDB: 5v8m | Chains: S, U | Done
99.55
Yes
10 Å
Yes
Avg A4D Score
-0.735
Max Score
1.5381
Min Score
-3.4405
Total Score
-160.97
Score CDR
-0.7646
Score non-CDR
-0.7286

Calculation Parameters

Chain Sequence(s) QVQLLQSGAAVTKPGASVRVSCEASGYNIRDYFIHWWRQAPGQGLQWVGWINPKTGQPNNPRQFQGRVSLTRHASWDFDTYSFYMDLKALRSDDTAVYFCARQRSDYWDFDVWGSGTQVTVDIQMTQSPSSLSASVGDTVTITCQANGYLNWYQQRRGKAPKLLIYDGSKLERGVPSRFSGRRWGQEYNLTINNLQPEDIATYFCQVYEFVVPGTRLDL input.pdb
Selected Chain(s) S (Heavy), U (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.4405
Maximum Score 1.5381
Average Score -0.735
Total Score -160.9735

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q S -1.1862 Soluble
2 V S -0.3320 Soluble
3 Q S -0.5302 Soluble
4 L S 0.0000 Buried
5 L S 0.7536 Aggregation-prone
6 Q S 0.0290 Aggregation-prone
7 S S -0.3963 Soluble
8 G S -0.4592 Soluble
9 A S 0.0982 Aggregation-prone
11 A S 0.6111 Aggregation-prone
12 V S 1.5381 Aggregation-prone
13 T S -0.1077 Soluble
14 K S -1.7198 Soluble
15 P S -1.6322 Soluble
16 G S -1.7305 Soluble
17 A S -1.1756 Soluble
18 S S -1.6295 Soluble
19 V S -1.0817 Soluble
20 R S -2.0685 Soluble
21 V S 0.0000 Buried
22 S S -0.4877 Soluble
23 C S 0.0000 Buried
24 E S -0.3104 Soluble
25 A S 0.0000 Buried
26 S S -0.8467 Soluble
27 G S -1.0947 Soluble
28 Y S -1.3261 Soluble
29 N S -2.0019 Soluble
30 I S 0.0000 Buried
35 R S -3.4405 Soluble
36 D S -3.0709 Soluble
37 Y S -1.6526 Soluble
38 F S -0.7198 Soluble
39 I S 0.0000 Buried
40 H S 0.0000 Buried
41 W S 0.0000 Buried
42 W S 0.0000 Buried
43 R S -0.4281 Soluble
44 Q S -0.7002 Soluble
45 A S -1.0662 Soluble
46 P S -1.1621 Soluble
47 G S -1.4820 Soluble
48 Q S -1.7668 Soluble
49 G S -1.0913 Soluble
50 L S -0.4608 Soluble
51 Q S -0.4335 Soluble
52 W S 0.0410 Aggregation-prone
53 V S 0.0000 Buried
54 G S 0.0000 Buried
55 W S -0.3155 Soluble
56 I S 0.0000 Buried
57 N S -1.6087 Soluble
58 P S 0.0000 Buried
59 K S -2.9380 Soluble
62 T S -1.6675 Soluble
63 G S -1.4771 Soluble
64 Q S -1.5763 Soluble
65 P S -1.0710 Soluble
66 N S -1.4121 Soluble
67 N S -1.7318 Soluble
68 P S -1.9739 Soluble
69 R S -3.0754 Soluble
70 Q S -2.6545 Soluble
71 F S 0.0000 Buried
72 Q S -2.7346 Soluble
74 G S -2.0096 Soluble
75 R S -1.8994 Soluble
76 V S 0.0000 Buried
77 S S -1.1682 Soluble
78 L S 0.0000 Buried
79 T S -0.7594 Soluble
80 R S -1.5053 Soluble
81 H S -1.0929 Soluble
82 A S -0.3744 Soluble
83 S S 0.0303 Aggregation-prone
84 W S 0.5322 Aggregation-prone
85 D S -0.8492 Soluble
85A F S 0.3621 Aggregation-prone
85B D S -1.3738 Soluble
85C T S -0.8522 Soluble
85D Y S -0.7127 Soluble
86 S S -0.5543 Soluble
87 F S 0.0000 Buried
88 Y S -0.6537 Soluble
89 M S 0.0000 Buried
90 D S -1.4887 Soluble
91 L S 0.0000 Buried
92 K S -2.3492 Soluble
93 A S -1.8243 Soluble
94 L S 0.0000 Buried
95 R S -2.8675 Soluble
96 S S -2.1642 Soluble
97 D S -2.4357 Soluble
98 D S 0.0000 Buried
99 T S -0.7158 Soluble
100 A S 0.0000 Buried
101 V S -0.1651 Soluble
102 Y S 0.0000 Buried
103 F S 0.0000 Buried
104 C S 0.0000 Buried
105 A S 0.0000 Buried
106 R S 0.0000 Buried
107 Q S -0.5392 Soluble
108 R S -0.7847 Soluble
109 S S -1.1021 Soluble
110 D S -1.4444 Soluble
112 Y S -0.2358 Soluble
113 W S 0.0000 Buried
114 D S 0.0000 Buried
115 F S 0.0000 Buried
116 D S 0.0000 Buried
117 V S 0.0000 Buried
118 W S 0.0000 Buried
119 G S 0.0000 Buried
120 S S -0.7101 Soluble
121 G S -0.4907 Soluble
122 T S 0.0000 Buried
123 Q S -0.0625 Soluble
124 V S 0.0000 Buried
125 T S 0.1374 Aggregation-prone
126 V S -0.3994 Soluble
1 D U -1.9809 Soluble
2 I U -0.9669 Soluble
3 Q U -1.5028 Soluble
4 M U -0.7999 Soluble
5 T U -0.8396 Soluble
6 Q U -0.6799 Soluble
7 S U -0.5497 Soluble
8 P U 0.0000 Buried
9 S U -0.5557 Soluble
10 S U -0.5401 Soluble
11 L U -0.0881 Soluble
12 S U 0.1601 Aggregation-prone
13 A U 0.1268 Aggregation-prone
14 S U 0.0798 Aggregation-prone
15 V U 0.1003 Aggregation-prone
16 G U -0.9765 Soluble
17 D U -1.2930 Soluble
18 T U -1.3801 Soluble
19 V U 0.0000 Buried
20 T U -0.3656 Soluble
21 I U 0.0000 Buried
22 T U -0.8106 Soluble
23 C U 0.0000 Buried
24 Q U -1.9372 Soluble
25 A U 0.0000 Buried
27 N U -1.9616 Soluble
28 G U -0.7871 Soluble
38 Y U 0.3633 Aggregation-prone
39 L U 0.0000 Buried
40 N U 0.0000 Buried
41 W U 0.0000 Buried
42 Y U 0.0000 Buried
43 Q U -0.9767 Soluble
44 Q U 0.0000 Buried
45 R U -2.4548 Soluble
46 R U -3.0352 Soluble
47 G U -2.3980 Soluble
48 K U -2.9419 Soluble
49 A U -1.7089 Soluble
50 P U 0.0000 Buried
51 K U -1.6439 Soluble
52 L U 0.0000 Buried
53 L U 0.0000 Buried
54 I U 0.0000 Buried
55 Y U -0.2376 Soluble
56 D U -0.4688 Soluble
57 G U 0.0000 Buried
65 S U -1.6362 Soluble
66 K U -2.0264 Soluble
67 L U -0.8794 Soluble
68 E U 0.0000 Buried
69 R U -2.0786 Soluble
70 G U -1.2129 Soluble
71 V U -0.7372 Soluble
72 P U -0.6557 Soluble
74 S U -0.7112 Soluble
75 R U -1.2867 Soluble
76 F U 0.0000 Buried
77 S U -1.0978 Soluble
78 G U -1.6523 Soluble
79 R U -2.7621 Soluble
80 R U -2.1927 Soluble
83 W U -0.8033 Soluble
84 G U -1.4140 Soluble
85 Q U -2.1690 Soluble
86 E U -2.3471 Soluble
87 Y U 0.0000 Buried
88 N U -1.4015 Soluble
89 L U 0.0000 Buried
90 T U -0.9057 Soluble
91 I U 0.0000 Buried
92 N U -2.1326 Soluble
93 N U -2.0790 Soluble
94 L U 0.0000 Buried
95 Q U -1.4031 Soluble
96 P U -1.0264 Soluble
97 E U -1.8421 Soluble
98 D U 0.0000 Buried
99 I U -0.4736 Soluble
100 A U 0.0000 Buried
101 T U -1.0040 Soluble
102 Y U 0.0000 Buried
103 F U 0.0000 Buried
104 C U 0.0000 Buried
105 Q U 0.0000 Buried
106 V U 0.0000 Buried
116 Y U 0.8789 Aggregation-prone
117 E U 0.4640 Aggregation-prone
118 F U 1.0790 Aggregation-prone
119 V U 0.5565 Aggregation-prone
120 V U 0.0000 Buried
121 P U -0.6832 Soluble
122 G U -0.9630 Soluble
123 T U 0.0000 Buried
124 R U -1.0492 Soluble
125 L U 0.0000 Buried
126 D U -0.1913 Soluble
127 L U 1.1958 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6113 4.9714 CSV PDB
4.5 -0.6506 4.691 CSV PDB
5.0 -0.6965 4.3449 CSV PDB
5.5 -0.7417 3.9599 CSV PDB
6.0 -0.7784 3.566 CSV PDB
6.5 -0.8021 3.1744 CSV PDB
7.0 -0.8143 2.8578 CSV PDB
7.5 -0.8198 2.599 CSV PDB
8.0 -0.8207 2.5347 CSV PDB
8.5 -0.8158 2.5326 CSV PDB
9.0 -0.803 2.5314 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH