Ogalvibart / 7k8z

A4DAB189_7k8z_M_N | Source PDB: 7k8z | Chains: M, N | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5978
Max Score
2.0049
Min Score
-3.0989
Total Score
-133.31
Score CDR
-0.5897
Score non-CDR
-0.5999

Calculation Parameters

Chain Sequence(s) QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVIPFDGRNKYYADSVTGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASSSGYLFHSDYWGQGTLVTVDIQMTQSPSTLSASVGDRVTITCRASQSISNWLAWFQQKPGKAPKLLIYEASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYPWTFGQGTKVEI input.pdb
Selected Chain(s) M (Heavy), N (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.0989
Maximum Score 2.0049
Average Score -0.5978
Total Score -133.3075

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q M -1.7031 Soluble
2 V M -1.3916 Soluble
3 Q M -1.4776 Soluble
4 L M 0.0000 Buried
5 V M 0.3180 Aggregation-prone
6 E M 0.0000 Buried
7 S M -0.3892 Soluble
8 G M -0.5844 Soluble
9 G M 0.0708 Aggregation-prone
11 G M 0.7500 Aggregation-prone
12 V M 1.6956 Aggregation-prone
13 V M -0.2852 Soluble
14 Q M -1.6884 Soluble
15 P M -2.2169 Soluble
16 G M -2.3770 Soluble
17 R M -2.9611 Soluble
18 S M -2.1499 Soluble
19 L M -1.1175 Soluble
20 R M -1.7134 Soluble
21 L M 0.0000 Buried
22 S M -0.5035 Soluble
23 C M 0.0000 Buried
24 A M -0.2749 Soluble
25 A M 0.0000 Buried
26 S M -0.7875 Soluble
27 G M -1.0043 Soluble
28 F M -0.4189 Soluble
29 T M -0.1025 Soluble
30 F M 0.0000 Buried
35 S M -0.5609 Soluble
36 S M 0.0086 Aggregation-prone
37 Y M 0.3537 Aggregation-prone
38 A M 0.3791 Aggregation-prone
39 M M 0.0000 Buried
40 H M 0.0000 Buried
41 W M 0.0000 Buried
42 V M 0.0000 Buried
43 R M 0.0000 Buried
44 Q M -0.7668 Soluble
45 A M -1.1857 Soluble
46 P M -1.0023 Soluble
47 G M -1.6358 Soluble
48 K M -2.4925 Soluble
49 G M -1.8426 Soluble
50 L M 0.0000 Buried
51 E M -0.9522 Soluble
52 W M 0.0000 Buried
53 V M 0.0000 Buried
54 A M 0.0000 Buried
55 V M 0.0000 Buried
56 I M 0.0000 Buried
57 P M -0.6434 Soluble
58 F M -0.1277 Soluble
59 D M -1.9731 Soluble
62 G M -2.1483 Soluble
63 R M -2.9986 Soluble
64 N M -2.4560 Soluble
65 K M -1.2833 Soluble
66 Y M 0.4439 Aggregation-prone
67 Y M 0.0664 Aggregation-prone
68 A M 0.0000 Buried
69 D M -1.7577 Soluble
70 S M -1.3620 Soluble
71 V M 0.0000 Buried
72 T M -0.8182 Soluble
74 G M -1.0112 Soluble
75 R M -0.9393 Soluble
76 F M 0.0000 Buried
77 T M -0.5148 Soluble
78 I M 0.0000 Buried
79 S M -0.4897 Soluble
80 R M -0.9826 Soluble
81 D M -1.4983 Soluble
82 N M -1.4881 Soluble
83 S M -1.5366 Soluble
84 K M -2.2807 Soluble
85 N M -1.6259 Soluble
86 T M -1.0392 Soluble
87 L M 0.0000 Buried
88 Y M 0.0000 Buried
89 L M 0.0000 Buried
90 Q M -1.0680 Soluble
91 M M 0.0000 Buried
92 N M -2.1273 Soluble
93 S M -2.1061 Soluble
94 L M 0.0000 Buried
95 R M -3.0989 Soluble
96 A M -1.8637 Soluble
97 E M -2.3545 Soluble
98 D M 0.0000 Buried
99 T M -0.3728 Soluble
100 A M 0.0000 Buried
101 V M 0.5597 Aggregation-prone
102 Y M 0.0000 Buried
103 Y M 0.0000 Buried
104 C M 0.0000 Buried
105 A M 0.0000 Buried
106 S M 0.0000 Buried
107 S M 0.0000 Buried
108 S M -0.2993 Soluble
109 G M 0.0951 Aggregation-prone
110 Y M 1.0952 Aggregation-prone
112 L M 0.0000 Buried
113 F M 0.0000 Buried
114 H M -0.8158 Soluble
115 S M -1.4298 Soluble
116 D M -2.2901 Soluble
117 Y M -1.1507 Soluble
118 W M 0.0000 Buried
119 G M 0.0000 Buried
120 Q M -1.1541 Soluble
121 G M -0.2355 Soluble
122 T M 0.3139 Aggregation-prone
123 L M 1.3242 Aggregation-prone
124 V M 0.0000 Buried
125 T M 0.4908 Aggregation-prone
126 V M -0.5326 Soluble
1 D N -2.2284 Soluble
2 I N 0.0000 Buried
3 Q N -2.1843 Soluble
4 M N 0.0000 Buried
5 T N -1.5459 Soluble
6 Q N 0.0000 Buried
7 S N -0.6201 Soluble
8 P N -0.3553 Soluble
9 S N -0.5795 Soluble
10 T N -0.3386 Soluble
11 L N 0.2357 Aggregation-prone
12 S N 0.3450 Aggregation-prone
13 A N 0.3824 Aggregation-prone
14 S N 0.5683 Aggregation-prone
15 V N 0.9564 Aggregation-prone
16 G N -0.5506 Soluble
17 D N -1.4649 Soluble
18 R N -2.1103 Soluble
19 V N 0.0000 Buried
20 T N -0.4197 Soluble
21 I N 0.0000 Buried
22 T N -0.9365 Soluble
23 C N 0.0000 Buried
24 R N -2.8533 Soluble
25 A N -2.2151 Soluble
26 S N -2.0916 Soluble
27 Q N -2.2892 Soluble
28 S N -1.2333 Soluble
29 I N 0.0000 Buried
36 S N -0.9447 Soluble
37 N N -0.8720 Soluble
38 W N -0.2647 Soluble
39 L N 0.0000 Buried
40 A N 0.0000 Buried
41 W N 0.0000 Buried
42 F N 0.0000 Buried
43 Q N 0.0000 Buried
44 Q N -1.2439 Soluble
45 K N -1.6450 Soluble
46 P N -1.2982 Soluble
47 G N -1.5408 Soluble
48 K N -2.1493 Soluble
49 A N -1.4492 Soluble
50 P N 0.0000 Buried
51 K N -1.8049 Soluble
52 L N 0.0000 Buried
53 L N 0.0000 Buried
54 I N 0.0000 Buried
55 Y N 0.3467 Aggregation-prone
56 E N -0.5031 Soluble
57 A N 0.0000 Buried
65 S N -0.2853 Soluble
66 S N 0.1536 Aggregation-prone
67 L N 0.6939 Aggregation-prone
68 E N -0.0040 Soluble
69 S N -0.4965 Soluble
70 G N -0.4510 Soluble
71 V N -0.0891 Soluble
72 P N -0.2464 Soluble
74 S N -0.3095 Soluble
75 R N -0.7709 Soluble
76 F N 0.0000 Buried
77 S N -0.1286 Soluble
78 G N -0.2551 Soluble
79 S N -0.8317 Soluble
80 G N -1.0999 Soluble
83 S N -1.0900 Soluble
84 G N -1.3095 Soluble
85 T N -1.9857 Soluble
86 E N -2.7999 Soluble
87 F N 0.0000 Buried
88 T N -0.8467 Soluble
89 L N 0.0000 Buried
90 T N -0.5727 Soluble
91 I N 0.0000 Buried
92 S N -1.2456 Soluble
93 S N -1.0283 Soluble
94 L N 0.0000 Buried
95 Q N -0.9297 Soluble
96 P N -0.6577 Soluble
97 D N -1.8316 Soluble
98 D N 0.0000 Buried
99 F N -0.1714 Soluble
100 A N 0.0000 Buried
101 T N -0.5867 Soluble
102 Y N 0.0000 Buried
103 Y N -0.3299 Soluble
104 C N 0.0000 Buried
105 Q N 0.0000 Buried
106 Q N 0.0000 Buried
107 Y N 0.0000 Buried
108 N N -1.0934 Soluble
109 S N -0.7076 Soluble
114 Y N -0.0315 Soluble
115 P N -0.4044 Soluble
116 W N 0.0000 Buried
117 T N -0.7278 Soluble
118 F N -0.4131 Soluble
119 G N 0.0000 Buried
120 Q N -1.5571 Soluble
121 G N 0.0000 Buried
122 T N 0.0000 Buried
123 K N -0.8419 Soluble
124 V N 0.0000 Buried
125 E N 0.3628 Aggregation-prone
126 I N 2.0049 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6009 2.8533 CSV PDB
4.5 -0.6413 2.8056 CSV PDB
5.0 -0.6869 2.7431 CSV PDB
5.5 -0.7312 2.6761 CSV PDB
6.0 -0.768 2.615 CSV PDB
6.5 -0.7925 2.5701 CSV PDB
7.0 -0.8046 2.5455 CSV PDB
7.5 -0.8083 2.5354 CSV PDB
8.0 -0.806 2.5318 CSV PDB
8.5 -0.7978 2.5307 CSV PDB
9.0 -0.7827 2.5303 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH