Teropavimab / 5v8m

A4DAB261_5v8m_R_T | Source PDB: 5v8m | Chains: R, T | Done
99.55
Yes
10 Å
Yes
Avg A4D Score
-0.7471
Max Score
1.5389
Min Score
-3.4405
Total Score
-163.61
Score CDR
-0.7844
Score non-CDR
-0.739

Calculation Parameters

Chain Sequence(s) QVQLLQSGAAVTKPGASVRVSCEASGYNIRDYFIHWWRQAPGQGLQWVGWINPKTGQPNNPRQFQGRVSLTRHASWDFDTYSFYMDLKALRSDDTAVYFCARQRSDYWDFDVWGSGTQVTVDIQMTQSPSSLSASVGDTVTITCQANGYLNWYQQRRGKAPKLLIYDGSKLERGVPSRFSGRRWGQEYNLTINNLQPEDIATYFCQVYEFVVPGTRLDL input.pdb
Selected Chain(s) R (Heavy), T (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.4405
Maximum Score 1.5389
Average Score -0.7471
Total Score -163.6134

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q R -1.1862 Soluble
2 V R -0.3320 Soluble
3 Q R -0.5303 Soluble
4 L R 0.0000 Buried
5 L R 0.7531 Aggregation-prone
6 Q R 0.0280 Aggregation-prone
7 S R -0.3971 Soluble
8 G R -0.4594 Soluble
9 A R 0.0981 Aggregation-prone
11 A R 0.6111 Aggregation-prone
12 V R 1.5389 Aggregation-prone
13 T R -0.1069 Soluble
14 K R -1.7190 Soluble
15 P R -1.6317 Soluble
16 G R -1.7302 Soluble
17 A R -1.1753 Soluble
18 S R -1.6298 Soluble
19 V R -1.0817 Soluble
20 R R -2.0689 Soluble
21 V R 0.0000 Buried
22 S R -0.4887 Soluble
23 C R 0.0000 Buried
24 E R -0.3123 Soluble
25 A R 0.0000 Buried
26 S R -0.8468 Soluble
27 G R -1.0948 Soluble
28 Y R -1.3263 Soluble
29 N R -2.0022 Soluble
30 I R 0.0000 Buried
35 R R -3.4405 Soluble
36 D R -3.0713 Soluble
37 Y R -1.6529 Soluble
38 F R -0.7184 Soluble
39 I R 0.0000 Buried
40 H R 0.0000 Buried
41 W R 0.0000 Buried
42 W R 0.0000 Buried
43 R R -0.4281 Soluble
44 Q R -0.7001 Soluble
45 A R -1.0660 Soluble
46 P R -1.1621 Soluble
47 G R -1.4821 Soluble
48 Q R -1.7669 Soluble
49 G R -1.0911 Soluble
50 L R -0.4607 Soluble
51 Q R -0.4333 Soluble
52 W R 0.0391 Aggregation-prone
53 V R 0.0000 Buried
54 G R 0.0000 Buried
55 W R -0.3158 Soluble
56 I R 0.0000 Buried
57 N R -1.6082 Soluble
58 P R 0.0000 Buried
59 K R -2.9389 Soluble
62 T R -1.6674 Soluble
63 G R -1.4787 Soluble
64 Q R -1.5761 Soluble
65 P R -1.0715 Soluble
66 N R -1.4127 Soluble
67 N R -1.7324 Soluble
68 P R -1.9743 Soluble
69 R R -3.0756 Soluble
70 Q R -2.6550 Soluble
71 F R 0.0000 Buried
72 Q R -2.7355 Soluble
74 G R -2.0108 Soluble
75 R R -1.9019 Soluble
76 V R 0.0000 Buried
77 S R -1.1698 Soluble
78 L R 0.0000 Buried
79 T R -0.7625 Soluble
80 R R -1.5109 Soluble
81 H R -1.1036 Soluble
82 A R -0.3794 Soluble
83 S R 0.0279 Aggregation-prone
84 W R 0.5307 Aggregation-prone
85 D R -0.8495 Soluble
85A F R 0.3611 Aggregation-prone
85B D R -1.3740 Soluble
85C T R -0.8539 Soluble
85D Y R -0.7159 Soluble
86 S R -0.5587 Soluble
87 F R 0.0000 Buried
88 Y R -0.6569 Soluble
89 M R 0.0000 Buried
90 D R -1.4896 Soluble
91 L R 0.0000 Buried
92 K R -2.3500 Soluble
93 A R -1.8249 Soluble
94 L R 0.0000 Buried
95 R R -2.8670 Soluble
96 S R -2.1637 Soluble
97 D R -2.4354 Soluble
98 D R 0.0000 Buried
99 T R -0.7153 Soluble
100 A R 0.0000 Buried
101 V R -0.1651 Soluble
102 Y R 0.0000 Buried
103 F R 0.0000 Buried
104 C R 0.0000 Buried
105 A R 0.0000 Buried
106 R R 0.0000 Buried
107 Q R -0.5396 Soluble
108 R R -0.7862 Soluble
109 S R -1.1048 Soluble
110 D R -1.4879 Soluble
112 Y R -0.3227 Soluble
113 W R 0.0000 Buried
114 D R 0.0000 Buried
115 F R 0.0000 Buried
116 D R 0.0000 Buried
117 V R 0.0000 Buried
118 W R 0.0000 Buried
119 G R 0.0000 Buried
120 S R -0.7104 Soluble
121 G R -0.4910 Soluble
122 T R 0.0000 Buried
123 Q R -0.0625 Soluble
124 V R 0.0000 Buried
125 T R 0.1386 Aggregation-prone
126 V R -0.3968 Soluble
1 D T -1.9755 Soluble
2 I T -0.9586 Soluble
3 Q T -1.4795 Soluble
4 M T -0.7349 Soluble
5 T T -0.7870 Soluble
6 Q T -0.6540 Soluble
7 S T -0.5367 Soluble
8 P T 0.0000 Buried
9 S T -0.5593 Soluble
10 S T -0.5876 Soluble
11 L T -0.1535 Soluble
12 S T 0.0902 Aggregation-prone
13 A T 0.0904 Aggregation-prone
14 S T 0.0742 Aggregation-prone
15 V T 0.1376 Aggregation-prone
16 G T -0.9727 Soluble
17 D T -1.3189 Soluble
18 T T -1.4623 Soluble
19 V T 0.0000 Buried
20 T T -0.5379 Soluble
21 I T 0.0000 Buried
22 T T -1.0041 Soluble
23 C T 0.0000 Buried
24 Q T -1.8091 Soluble
25 A T 0.0000 Buried
27 N T -1.9070 Soluble
28 G T -0.8400 Soluble
38 Y T 0.0745 Aggregation-prone
39 L T 0.0000 Buried
40 N T 0.0000 Buried
41 W T 0.0000 Buried
42 Y T 0.0000 Buried
43 Q T -0.9807 Soluble
44 Q T 0.0000 Buried
45 R T -2.4568 Soluble
46 R T -3.0349 Soluble
47 G T -2.3979 Soluble
48 K T -2.9426 Soluble
49 A T -1.7105 Soluble
50 P T 0.0000 Buried
51 K T -1.6509 Soluble
52 L T 0.0000 Buried
53 L T 0.0000 Buried
54 I T 0.0000 Buried
55 Y T -0.3208 Soluble
56 D T -0.6025 Soluble
57 G T 0.0000 Buried
65 S T -1.7775 Soluble
66 K T -2.0553 Soluble
67 L T -0.8963 Soluble
68 E T 0.0000 Buried
69 R T -2.0786 Soluble
70 G T -1.2130 Soluble
71 V T -0.7392 Soluble
72 P T -0.6799 Soluble
74 S T -0.7504 Soluble
75 R T -1.3713 Soluble
76 F T 0.0000 Buried
77 S T -1.2598 Soluble
78 G T -1.9022 Soluble
79 R T -2.9306 Soluble
80 R T -2.2018 Soluble
83 W T -0.7100 Soluble
84 G T -1.2560 Soluble
85 Q T -1.8817 Soluble
86 E T -2.1452 Soluble
87 Y T 0.0000 Buried
88 N T -1.9417 Soluble
89 L T 0.0000 Buried
90 T T -1.1172 Soluble
91 I T 0.0000 Buried
92 N T -2.3376 Soluble
93 N T -2.1625 Soluble
94 L T 0.0000 Buried
95 Q T -1.3549 Soluble
96 P T -1.0048 Soluble
97 E T -1.8160 Soluble
98 D T 0.0000 Buried
99 I T -0.5046 Soluble
100 A T 0.0000 Buried
101 T T -1.0309 Soluble
102 Y T 0.0000 Buried
103 F T 0.0000 Buried
104 C T 0.0000 Buried
105 Q T 0.0000 Buried
106 V T 0.0000 Buried
116 Y T 0.8189 Aggregation-prone
117 E T 0.4575 Aggregation-prone
118 F T 1.0737 Aggregation-prone
119 V T 0.5541 Aggregation-prone
120 V T 0.0000 Buried
121 P T -0.6830 Soluble
122 G T -0.9661 Soluble
123 T T 0.0000 Buried
124 R T -1.1079 Soluble
125 L T 0.0000 Buried
126 D T -0.3746 Soluble
127 L T 1.1116 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6187 4.9604 CSV PDB
4.5 -0.6573 4.688 CSV PDB
5.0 -0.7027 4.3506 CSV PDB
5.5 -0.7476 3.971 CSV PDB
6.0 -0.7844 3.5797 CSV PDB
6.5 -0.8085 3.1894 CSV PDB
7.0 -0.8216 2.8503 CSV PDB
7.5 -0.8281 2.5925 CSV PDB
8.0 -0.83 2.529 CSV PDB
8.5 -0.826 2.5268 CSV PDB
9.0 -0.8137 2.5255 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH