Cemiplimab / 7wvm

A4DAB061_7wvm_C_D | Source PDB: 7wvm | Chains: C, D | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5573
Max Score
2.5964
Min Score
-2.8307
Total Score
-124.28
Score CDR
-0.5954
Score non-CDR
-0.548

Calculation Parameters

Chain Sequence(s) EVQLLESGGVLVQPGGSLRLSCAASGFTFSNFGMTWVRQAPGKGLEWVSGISGGGRDTYFADSVKGRFTISRDNSKNTLYLQMNSLKGEDTAVYYCVKWGNIYFDYWGQGTLVTVSDIQMTQSPSSLSASVGDSITITCRASLSINTFLNWYQQKPGKAPNLLIYAASSLHGGVPSRFSGSGSGTDFTLTIRTLQPEDFATYYCQQSSNTPFTFGPGTVVDFR input.pdb
Selected Chain(s) C (Heavy), D (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.8307
Maximum Score 2.5964
Average Score -0.5573
Total Score -124.2817

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E C -1.9206 Soluble
2 V C -0.9982 Soluble
3 Q C -0.7870 Soluble
4 L C 0.0000 Buried
5 L C 0.3639 Aggregation-prone
6 E C -0.0059 Soluble
7 S C -0.0440 Soluble
8 G C 0.0079 Aggregation-prone
9 G C 1.1689 Aggregation-prone
11 V C 2.5964 Aggregation-prone
12 L C 2.2571 Aggregation-prone
13 V C 0.0000 Buried
14 Q C -1.2277 Soluble
15 P C -1.6635 Soluble
16 G C -1.3765 Soluble
17 G C -1.0682 Soluble
18 S C -1.1302 Soluble
19 L C -0.6085 Soluble
20 R C -1.9677 Soluble
21 L C 0.0000 Buried
22 S C -0.4291 Soluble
23 C C 0.0000 Buried
24 A C -0.2314 Soluble
25 A C 0.0000 Buried
26 S C -0.8830 Soluble
27 G C -0.9707 Soluble
28 F C -0.4703 Soluble
29 T C -0.5042 Soluble
30 F C 0.0000 Buried
35 S C -1.1866 Soluble
36 N C -1.3242 Soluble
37 F C -0.6035 Soluble
38 G C 0.0000 Buried
39 M C 0.0000 Buried
40 T C 0.0000 Buried
41 W C 0.0000 Buried
42 V C 0.0000 Buried
43 R C 0.0000 Buried
44 Q C -0.7512 Soluble
45 A C -1.1299 Soluble
46 P C -0.8355 Soluble
47 G C -1.5072 Soluble
48 K C -2.2921 Soluble
49 G C -1.5105 Soluble
50 L C 0.0000 Buried
51 E C -1.2413 Soluble
52 W C 0.0000 Buried
53 V C 0.0000 Buried
54 S C 0.0000 Buried
55 G C 0.0000 Buried
56 I C 0.0000 Buried
57 S C -1.4226 Soluble
58 G C 0.0000 Buried
59 G C -1.8526 Soluble
62 G C -2.0886 Soluble
63 R C -2.8307 Soluble
64 D C -2.4020 Soluble
65 T C -0.9268 Soluble
66 Y C -0.1204 Soluble
67 F C -0.5080 Soluble
68 A C 0.0000 Buried
69 D C -2.3238 Soluble
70 S C -1.7470 Soluble
71 V C 0.0000 Buried
72 K C -2.4354 Soluble
74 G C -1.7098 Soluble
75 R C -1.3551 Soluble
76 F C 0.0000 Buried
77 T C -0.7060 Soluble
78 I C 0.0000 Buried
79 S C -0.6987 Soluble
80 R C -1.1864 Soluble
81 D C -1.9419 Soluble
82 N C -2.0655 Soluble
83 S C -1.7307 Soluble
84 K C -2.4825 Soluble
85 N C -1.9166 Soluble
86 T C -1.1499 Soluble
87 L C 0.0000 Buried
88 Y C -0.4238 Soluble
89 L C 0.0000 Buried
90 Q C -1.0508 Soluble
91 M C 0.0000 Buried
92 N C -1.2558 Soluble
93 S C -1.0069 Soluble
94 L C 0.0000 Buried
95 K C -2.1795 Soluble
96 G C -2.0797 Soluble
97 E C -2.3843 Soluble
98 D C 0.0000 Buried
99 T C -0.4555 Soluble
100 A C 0.0000 Buried
101 V C 0.6687 Aggregation-prone
102 Y C 0.0000 Buried
103 Y C 0.0000 Buried
104 C C 0.0000 Buried
105 V C 0.0000 Buried
106 K C -0.1853 Soluble
107 W C -0.3106 Soluble
108 G C -0.9505 Soluble
109 N C -1.1097 Soluble
113 I C 0.0871 Aggregation-prone
114 Y C 0.0500 Aggregation-prone
115 F C 0.0000 Buried
116 D C -0.5786 Soluble
117 Y C -0.2401 Soluble
118 W C 0.0000 Buried
119 G C 0.0000 Buried
120 Q C -1.4027 Soluble
121 G C -0.3983 Soluble
122 T C 0.7090 Aggregation-prone
123 L C 1.9173 Aggregation-prone
124 V C 0.0000 Buried
125 T C 0.8024 Aggregation-prone
126 V C 0.0000 Buried
127 S C -0.8274 Soluble
1 D D -2.1901 Soluble
2 I D 0.0000 Buried
3 Q D -1.5592 Soluble
4 M D 0.0000 Buried
5 T D -0.9880 Soluble
6 Q D 0.0000 Buried
7 S D -0.3362 Soluble
8 P D -0.1239 Soluble
9 S D -0.1164 Soluble
10 S D -0.1779 Soluble
11 L D -0.1023 Soluble
12 S D -0.6190 Soluble
13 A D 0.0000 Buried
14 S D -0.3558 Soluble
15 V D 0.1357 Aggregation-prone
16 G D -0.8763 Soluble
17 D D -1.2472 Soluble
18 S D -1.3107 Soluble
19 I D 0.0000 Buried
20 T D -0.5131 Soluble
21 I D 0.0000 Buried
22 T D -0.7400 Soluble
23 C D 0.0000 Buried
24 R D -1.6838 Soluble
25 A D 0.0000 Buried
26 S D -0.6174 Soluble
27 L D 0.3515 Aggregation-prone
28 S D -0.2365 Soluble
29 I D 0.0000 Buried
36 N D -1.3131 Soluble
37 T D -0.3409 Soluble
38 F D 0.4585 Aggregation-prone
39 L D 0.0000 Buried
40 N D 0.0000 Buried
41 W D 0.0000 Buried
42 Y D 0.0000 Buried
43 Q D 0.0000 Buried
44 Q D 0.0000 Buried
45 K D -1.5431 Soluble
46 P D -1.3071 Soluble
47 G D -1.7256 Soluble
48 K D -2.6248 Soluble
49 A D -1.6555 Soluble
50 P D 0.0000 Buried
51 N D -1.2996 Soluble
52 L D 0.0000 Buried
53 L D 0.0000 Buried
54 I D 0.0000 Buried
55 Y D 0.4473 Aggregation-prone
56 A D 0.1788 Aggregation-prone
57 A D 0.0000 Buried
65 S D -0.1109 Soluble
66 S D 0.1347 Aggregation-prone
67 L D 0.3328 Aggregation-prone
68 H D -0.3157 Soluble
69 G D -0.6676 Soluble
70 G D -0.6839 Soluble
71 V D 0.0000 Buried
72 P D -0.3915 Soluble
74 S D -0.5916 Soluble
75 R D -1.0389 Soluble
76 F D 0.0000 Buried
77 S D -0.4764 Soluble
78 G D -0.2348 Soluble
79 S D -0.7712 Soluble
80 G D -1.3719 Soluble
83 S D -1.3284 Soluble
84 G D -1.1411 Soluble
85 T D -1.2718 Soluble
86 D D -2.3547 Soluble
87 F D 0.0000 Buried
88 T D -0.7660 Soluble
89 L D 0.0000 Buried
90 T D -0.7218 Soluble
91 I D 0.0000 Buried
92 R D -2.3577 Soluble
93 T D -1.4196 Soluble
94 L D 0.0000 Buried
95 Q D -1.2697 Soluble
96 P D -0.9851 Soluble
97 E D -1.9745 Soluble
98 D D 0.0000 Buried
99 F D -0.3041 Soluble
100 A D 0.0000 Buried
101 T D 0.0277 Aggregation-prone
102 Y D 0.0000 Buried
103 Y D 0.0000 Buried
104 C D 0.0000 Buried
105 Q D 0.0000 Buried
106 Q D 0.0000 Buried
107 S D -0.0948 Soluble
108 S D -0.5714 Soluble
109 N D -1.5702 Soluble
114 T D -0.9614 Soluble
115 P D -1.1424 Soluble
116 F D 0.0000 Buried
117 T D -1.0221 Soluble
118 F D 0.0000 Buried
119 G D 0.0000 Buried
120 P D -0.6475 Soluble
121 G D -0.2782 Soluble
122 T D 0.0000 Buried
123 V D 0.4850 Aggregation-prone
124 V D 0.0000 Buried
125 D D -0.9927 Soluble
126 F D 0.3250 Aggregation-prone
127 R D -1.2451 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.4119 2.6967 CSV PDB
4.5 -0.4512 2.6967 CSV PDB
5.0 -0.4959 2.6967 CSV PDB
5.5 -0.5396 2.6967 CSV PDB
6.0 -0.5763 2.6967 CSV PDB
6.5 -0.6018 2.6967 CSV PDB
7.0 -0.6162 2.6967 CSV PDB
7.5 -0.6235 2.6967 CSV PDB
8.0 -0.6257 2.6967 CSV PDB
8.5 -0.6221 2.6967 CSV PDB
9.0 -0.6111 2.6967 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH