Masavibart / 8j26

A4DAB166_8j26_B_A | Source PDB: 8j26 | Chains: B, A | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.6425
Max Score
1.9847
Min Score
-3.1423
Total Score
-148.42
Score CDR
-0.4192
Score non-CDR
-0.7058

Calculation Parameters

Chain Sequence(s) QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMYWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDYGDYLLVYWGQGTLVTVSSASALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGVSNRFSGSKSGNTASLTISGLQSEDEADYYCNSLTSISTWVFGGGTKLTVLG input.pdb
Selected Chain(s) B (Heavy), A (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.1423
Maximum Score 1.9847
Average Score -0.6425
Total Score -148.4183

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q B -1.3355 Soluble
2 V B -0.8535 Soluble
3 Q B -1.1430 Soluble
4 L B 0.0000 Buried
5 V B 0.8343 Aggregation-prone
6 E B 0.3921 Aggregation-prone
7 S B -0.0901 Soluble
8 G B -0.0563 Soluble
9 G B 0.0036 Aggregation-prone
11 G B 0.5511 Aggregation-prone
12 V B 1.4912 Aggregation-prone
13 V B -0.1001 Soluble
14 Q B -1.5674 Soluble
15 P B -2.0850 Soluble
16 G B -2.3687 Soluble
17 R B -2.9184 Soluble
18 S B -2.1602 Soluble
19 L B -1.7190 Soluble
20 R B -2.1323 Soluble
21 L B 0.0000 Buried
22 S B -0.3647 Soluble
23 C B 0.0000 Buried
24 A B -0.1565 Soluble
25 A B 0.0000 Buried
26 S B -0.6923 Soluble
27 G B -0.8592 Soluble
28 F B -0.5584 Soluble
29 T B -0.7484 Soluble
30 F B 0.0000 Buried
35 S B -1.1588 Soluble
36 N B -1.5639 Soluble
37 Y B -0.8643 Soluble
38 A B -0.5931 Soluble
39 M B 0.0000 Buried
40 Y B 0.0000 Buried
41 W B 0.0000 Buried
42 V B 0.0000 Buried
43 R B -0.4177 Soluble
44 Q B -0.7000 Soluble
45 A B -1.0653 Soluble
46 P B -0.8391 Soluble
47 G B -1.5151 Soluble
48 K B -2.2890 Soluble
49 G B -1.5084 Soluble
50 L B 0.0000 Buried
51 E B -1.0341 Soluble
52 W B 0.0000 Buried
53 V B 0.0000 Buried
54 A B 0.0000 Buried
55 V B 0.0000 Buried
56 I B 0.0000 Buried
57 S B -0.9250 Soluble
58 Y B -0.5343 Soluble
59 D B -1.9834 Soluble
62 G B -1.4867 Soluble
63 S B -1.3437 Soluble
64 N B -1.6815 Soluble
65 K B -1.2080 Soluble
66 Y B -0.1789 Soluble
67 Y B -0.7943 Soluble
68 A B -1.2846 Soluble
69 D B -2.4389 Soluble
70 S B -1.6510 Soluble
71 V B 0.0000 Buried
72 K B -2.6109 Soluble
74 G B -1.9111 Soluble
75 R B -1.6310 Soluble
76 F B 0.0000 Buried
77 T B -0.9868 Soluble
78 I B 0.0000 Buried
79 S B -0.8275 Soluble
80 R B -1.0938 Soluble
81 D B -1.8769 Soluble
82 N B -2.1729 Soluble
83 S B -1.7470 Soluble
84 K B -2.4722 Soluble
85 N B -2.0609 Soluble
86 T B -1.0887 Soluble
87 L B 0.0000 Buried
88 Y B -0.5190 Soluble
89 L B 0.0000 Buried
90 Q B -1.4431 Soluble
91 M B 0.0000 Buried
92 N B -2.6942 Soluble
93 S B -2.1675 Soluble
94 L B 0.0000 Buried
95 R B -3.1423 Soluble
96 T B -2.1055 Soluble
97 E B -2.4702 Soluble
98 D B 0.0000 Buried
99 T B -0.4407 Soluble
100 A B 0.0000 Buried
101 V B 0.7516 Aggregation-prone
102 Y B 0.0000 Buried
103 Y B 0.0000 Buried
104 C B 0.0000 Buried
105 A B 0.0000 Buried
106 S B 0.0000 Buried
107 G B 0.0000 Buried
108 S B -0.7522 Soluble
109 D B -1.2131 Soluble
110 Y B 0.2888 Aggregation-prone
111 G B -0.5599 Soluble
112 D B -1.6241 Soluble
113 Y B -0.3878 Soluble
114 L B 0.0000 Buried
115 L B 0.0000 Buried
116 V B -0.0642 Soluble
117 Y B -0.1373 Soluble
118 W B 0.0000 Buried
119 G B 0.0000 Buried
120 Q B -1.2332 Soluble
121 G B -0.1995 Soluble
122 T B 0.5363 Aggregation-prone
123 L B 1.5772 Aggregation-prone
124 V B 0.0000 Buried
125 T B 0.3811 Aggregation-prone
126 V B 0.0000 Buried
127 S B -0.5798 Soluble
128 S B -0.3871 Soluble
129 A B -0.0848 Soluble
130 S B -0.0671 Soluble
3 A A 0.0302 Aggregation-prone
4 L A 0.0547 Aggregation-prone
5 T A -0.1960 Soluble
6 Q A -0.3321 Soluble
7 P A -0.4945 Soluble
8 A A -0.5093 Soluble
9 S A -0.8429 Soluble
11 V A -0.4323 Soluble
12 S A -0.2394 Soluble
13 G A 0.0000 Buried
14 S A -0.1994 Soluble
15 P A -0.9310 Soluble
16 G A -1.4091 Soluble
17 Q A -1.4803 Soluble
18 S A -0.9648 Soluble
19 I A 0.0000 Buried
20 T A -0.2034 Soluble
21 I A 0.0000 Buried
22 S A -0.3927 Soluble
23 C A 0.0000 Buried
24 T A -0.4658 Soluble
25 G A -0.3243 Soluble
26 T A -0.4890 Soluble
27 S A -0.6523 Soluble
28 S A -0.5274 Soluble
29 D A 0.0000 Buried
30 V A 0.0000 Buried
31 G A -1.0383 Soluble
35 G A -0.6693 Soluble
36 Y A 0.1072 Aggregation-prone
37 N A -0.8990 Soluble
38 Y A 0.1393 Aggregation-prone
39 V A 0.0000 Buried
40 S A 0.0000 Buried
41 W A 0.0000 Buried
42 Y A 0.0000 Buried
43 Q A 0.0000 Buried
44 Q A 0.0000 Buried
45 H A -1.7106 Soluble
46 P A -1.2225 Soluble
47 G A -1.3462 Soluble
48 K A -2.2098 Soluble
49 A A 0.0000 Buried
50 P A 0.0000 Buried
51 K A -1.2876 Soluble
52 L A 0.0000 Buried
53 M A -0.7990 Soluble
54 I A 0.0000 Buried
55 Y A -0.8439 Soluble
56 D A -0.8011 Soluble
57 V A -0.7781 Soluble
65 S A -1.4579 Soluble
66 K A -2.5701 Soluble
67 R A -2.7488 Soluble
68 P A -1.2496 Soluble
69 S A -1.0604 Soluble
70 G A -0.8153 Soluble
71 V A -0.7977 Soluble
72 S A -1.0571 Soluble
74 N A -1.9107 Soluble
75 R A -1.3375 Soluble
76 F A 0.0000 Buried
77 S A -1.2153 Soluble
78 G A -0.9171 Soluble
79 S A -0.7762 Soluble
80 K A -1.1358 Soluble
83 S A -0.9317 Soluble
84 G A -1.2732 Soluble
85 N A -1.2622 Soluble
86 T A -0.8283 Soluble
87 A A 0.0000 Buried
88 S A -0.3708 Soluble
89 L A 0.0000 Buried
90 T A -0.3732 Soluble
91 I A 0.0000 Buried
92 S A -1.2491 Soluble
93 G A -1.3335 Soluble
94 L A 0.0000 Buried
95 Q A -2.3249 Soluble
96 S A -1.7847 Soluble
97 E A -2.6285 Soluble
98 D A -2.1314 Soluble
99 E A -2.2582 Soluble
100 A A 0.0000 Buried
101 D A -1.2739 Soluble
102 Y A 0.0000 Buried
103 Y A 0.0000 Buried
104 C A 0.0000 Buried
105 N A 0.0000 Buried
106 S A 0.0000 Buried
107 L A 0.6077 Aggregation-prone
108 T A 0.0000 Buried
109 S A 0.8315 Aggregation-prone
113 I A 1.9847 Aggregation-prone
114 S A 1.1185 Aggregation-prone
115 T A 0.4455 Aggregation-prone
116 W A 0.0000 Buried
117 V A 0.1680 Aggregation-prone
118 F A 0.0000 Buried
119 G A 0.0000 Buried
120 G A -0.7391 Soluble
121 G A -1.2166 Soluble
122 T A 0.0000 Buried
123 K A -2.0929 Soluble
124 L A 0.0000 Buried
125 T A -0.8224 Soluble
126 V A 0.0250 Aggregation-prone
127 L A 1.3112 Aggregation-prone
128 G A 0.3068 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.7451 2.4393 CSV PDB
4.5 -0.7821 2.4393 CSV PDB
5.0 -0.8217 2.4393 CSV PDB
5.5 -0.8583 2.4393 CSV PDB
6.0 -0.885 2.4393 CSV PDB
6.5 -0.8957 2.4393 CSV PDB
7.0 -0.8905 2.4393 CSV PDB
7.5 -0.8744 2.4392 CSV PDB
8.0 -0.8509 2.4392 CSV PDB
8.5 -0.8207 2.439 CSV PDB
9.0 -0.7845 2.4386 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH