Larcaviximab / 5ken

A4DAB152_5ken_C_D | Source PDB: 5ken | Chains: C, D | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.6422
Max Score
1.4939
Min Score
-3.0042
Total Score
-144.5
Score CDR
-0.0335
Score non-CDR
-0.7987

Calculation Parameters

Chain Sequence(s) EVQLQESGPELEMPGASVKISCKASGSSFTGFSMNWVKQSNGKSLEWIGNIDTYYGGTTYNQKFKGKATLTVDKSSSTAYMQLKSLTSEDSAVYYCARSAYYGSTFAYWGQGTLVTVSDIQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYNAKTLIEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYFCQHHFGTPFTFGSGTELEIK input.pdb
Selected Chain(s) C (Heavy), D (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.0042
Maximum Score 1.4939
Average Score -0.6422
Total Score -144.5019

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E C -2.0528 Soluble
2 V C -1.1415 Soluble
3 Q C -1.7309 Soluble
4 L C 0.0000 Buried
5 Q C -2.1829 Soluble
6 E C -1.5677 Soluble
7 S C -1.2446 Soluble
8 G C -1.4239 Soluble
9 P C -1.1689 Soluble
11 E C -1.5460 Soluble
12 L C 0.0920 Aggregation-prone
13 E C -0.2033 Soluble
14 M C 0.6296 Aggregation-prone
15 P C -0.3078 Soluble
16 G C -0.7937 Soluble
17 A C -0.6081 Soluble
18 S C -1.1965 Soluble
19 V C -1.3608 Soluble
20 K C -1.8225 Soluble
21 I C 0.0000 Buried
22 S C -0.8411 Soluble
23 C C 0.0000 Buried
24 K C -1.6361 Soluble
25 A C -1.3883 Soluble
26 S C -1.4319 Soluble
27 G C -1.0856 Soluble
28 S C -0.8249 Soluble
29 S C -0.7190 Soluble
30 F C 0.0000 Buried
35 T C -0.1813 Soluble
36 G C -0.2160 Soluble
37 F C 0.0000 Buried
38 S C -0.0575 Soluble
39 M C 0.0000 Buried
40 N C 0.0000 Buried
41 W C 0.0000 Buried
42 V C 0.0000 Buried
43 K C -0.7936 Soluble
44 Q C -1.4680 Soluble
45 S C -1.9779 Soluble
46 N C -2.4833 Soluble
47 G C -2.1078 Soluble
48 K C -2.5087 Soluble
49 S C -1.3957 Soluble
50 L C 0.0000 Buried
51 E C -1.0297 Soluble
52 W C 0.0000 Buried
53 I C 0.0000 Buried
54 G C 0.0000 Buried
55 N C -0.2257 Soluble
56 I C 0.0000 Buried
57 D C -0.0142 Soluble
58 T C 0.0000 Buried
59 Y C 1.3703 Aggregation-prone
62 Y C 1.4939 Aggregation-prone
63 G C 0.3552 Aggregation-prone
64 G C -0.0056 Soluble
65 T C -0.1022 Soluble
66 T C -0.1649 Soluble
67 Y C -0.3017 Soluble
68 N C 0.0000 Buried
69 Q C -2.3434 Soluble
70 K C -2.9222 Soluble
71 F C -2.1783 Soluble
72 K C -3.0042 Soluble
74 G C -2.4724 Soluble
75 K C -2.3110 Soluble
76 A C -1.2786 Soluble
77 T C -0.7127 Soluble
78 L C -0.2188 Soluble
79 T C -0.3748 Soluble
80 V C -0.0538 Soluble
81 D C -0.9561 Soluble
82 K C -1.0252 Soluble
83 S C -0.8817 Soluble
84 S C -0.8006 Soluble
85 S C -0.9921 Soluble
86 T C 0.0000 Buried
87 A C 0.0000 Buried
88 Y C -0.3611 Soluble
89 M C 0.0000 Buried
90 Q C -1.4264 Soluble
91 L C 0.0000 Buried
92 K C -2.4287 Soluble
93 S C -1.3590 Soluble
94 L C 0.0000 Buried
95 T C -1.3073 Soluble
96 S C -1.3740 Soluble
97 E C -2.5142 Soluble
98 D C -2.0903 Soluble
99 S C -1.4516 Soluble
100 A C 0.0000 Buried
101 V C -0.5655 Soluble
102 Y C 0.0000 Buried
103 Y C 0.0000 Buried
104 C C 0.0000 Buried
105 A C 0.0000 Buried
106 R C 0.0000 Buried
107 S C 0.0000 Buried
108 A C 0.0000 Buried
109 Y C 1.2159 Aggregation-prone
110 Y C 1.1680 Aggregation-prone
112 G C 0.2733 Aggregation-prone
113 S C 0.0486 Aggregation-prone
114 T C 0.2585 Aggregation-prone
115 F C 0.4689 Aggregation-prone
116 A C 0.0000 Buried
117 Y C -0.1120 Soluble
118 W C 0.0000 Buried
119 G C -1.7271 Soluble
120 Q C -1.9085 Soluble
121 G C -1.4318 Soluble
122 T C 0.0000 Buried
123 L C -0.3251 Soluble
124 V C 0.0000 Buried
125 T C -0.6872 Soluble
126 V C 0.0000 Buried
127 S C -0.0755 Soluble
1 D D -2.4818 Soluble
2 I D -1.6572 Soluble
3 Q D -2.0449 Soluble
4 M D -1.4229 Soluble
5 T D -0.8961 Soluble
6 Q D 0.0000 Buried
7 S D -0.4632 Soluble
8 P D -0.2368 Soluble
9 A D -0.2312 Soluble
10 S D -0.4476 Soluble
11 L D -0.0755 Soluble
12 S D -0.2988 Soluble
13 A D 0.0000 Buried
14 S D -0.0143 Soluble
15 V D 0.5391 Aggregation-prone
16 G D -0.4224 Soluble
17 E D -0.7505 Soluble
18 T D -0.8440 Soluble
19 V D 0.0000 Buried
20 T D -0.5030 Soluble
21 I D 0.0000 Buried
22 T D -0.7318 Soluble
23 C D 0.0000 Buried
24 R D -2.2790 Soluble
25 A D 0.0000 Buried
26 S D -2.2661 Soluble
27 E D -2.9920 Soluble
28 N D -1.9766 Soluble
29 I D 0.0000 Buried
36 Y D 0.8773 Aggregation-prone
37 S D 0.0427 Aggregation-prone
38 Y D 0.7454 Aggregation-prone
39 L D 0.0000 Buried
40 A D 0.0000 Buried
41 W D 0.0000 Buried
42 Y D 0.0000 Buried
43 Q D -0.9797 Soluble
44 Q D 0.0000 Buried
45 K D -2.5790 Soluble
46 Q D -2.5469 Soluble
47 G D -2.3475 Soluble
48 K D -2.9967 Soluble
49 S D -1.6858 Soluble
50 P D 0.0000 Buried
51 Q D -0.8008 Soluble
52 L D 0.0000 Buried
53 L D 0.0000 Buried
54 V D 0.0000 Buried
55 Y D 0.2187 Aggregation-prone
56 N D -0.1760 Soluble
57 A D 0.0000 Buried
65 K D -1.8231 Soluble
66 T D -0.8769 Soluble
67 L D -0.3197 Soluble
68 I D -0.4001 Soluble
69 E D -1.8089 Soluble
70 G D -1.1616 Soluble
71 V D -0.6039 Soluble
72 P D -0.5435 Soluble
74 S D -0.6436 Soluble
75 R D -0.8552 Soluble
76 F D 0.0000 Buried
77 S D -0.8781 Soluble
78 G D -1.1263 Soluble
79 S D -1.3265 Soluble
80 G D -1.2814 Soluble
83 S D -1.0719 Soluble
84 G D 0.0000 Buried
85 T D -2.1039 Soluble
86 Q D -2.2332 Soluble
87 F D 0.0000 Buried
88 S D -1.0560 Soluble
89 L D 0.0000 Buried
90 K D -1.0892 Soluble
91 I D 0.0000 Buried
92 N D -1.1590 Soluble
93 S D -0.8518 Soluble
94 L D 0.0000 Buried
95 Q D -0.6796 Soluble
96 P D -0.7717 Soluble
97 E D -2.0248 Soluble
98 D D 0.0000 Buried
99 F D 0.0000 Buried
100 G D 0.0000 Buried
101 S D -1.1322 Soluble
102 Y D 0.0000 Buried
103 F D 0.0000 Buried
104 C D 0.0000 Buried
105 Q D 0.0000 Buried
106 H D 0.0000 Buried
107 H D 0.0000 Buried
108 F D 1.2415 Aggregation-prone
109 G D 0.4283 Aggregation-prone
114 T D -0.0350 Soluble
115 P D -0.6278 Soluble
116 F D 0.0000 Buried
117 T D -0.5797 Soluble
118 F D 0.0000 Buried
119 G D 0.0000 Buried
120 S D -0.7640 Soluble
121 G D -0.6345 Soluble
122 T D 0.0000 Buried
123 E D -1.1360 Soluble
124 L D 0.0000 Buried
125 E D -0.4457 Soluble
126 I D 0.9305 Aggregation-prone
127 K D -0.7229 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6447 2.777 CSV PDB
4.5 -0.6839 2.777 CSV PDB
5.0 -0.7317 2.777 CSV PDB
5.5 -0.7764 2.777 CSV PDB
6.0 -0.8045 2.777 CSV PDB
6.5 -0.8046 2.777 CSV PDB
7.0 -0.7754 2.777 CSV PDB
7.5 -0.7266 2.7769 CSV PDB
8.0 -0.6682 2.7766 CSV PDB
8.5 -0.6049 2.7756 CSV PDB
9.0 -0.539 2.7727 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH