Bimagrumab / 5ngv

A4DAB047_5ngv_H_L | Source PDB: 5ngv | Chains: H, L | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5012
Max Score
1.8355
Min Score
-3.4201
Total Score
-112.27
Score CDR
-0.0544
Score non-CDR
-0.6199

Calculation Parameters

Chain Sequence(s) VQLVQSGAEVKKPGASVKVSCKASGYTFTSSYINWVRQAPGQGLEWMGTINPVSGSTSYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGGWFDYWGQGTLVTVSSALTQPASVSGSPGQSITISCTGTSSDVGSYNYVNWYQQHPGKAPKLMIYGVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCGTFAGGSYYGVFGGGTKLTVLW input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.4201
Maximum Score 1.8355
Average Score -0.5012
Total Score -112.272

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V H 0.5222 Aggregation-prone
3 Q H -0.6958 Soluble
4 L H 0.0000 Buried
5 V H -0.3178 Soluble
6 Q H 0.0000 Buried
7 S H -0.6677 Soluble
8 G H -0.6483 Soluble
9 A H 0.0243 Aggregation-prone
11 E H -0.4483 Soluble
12 V H 0.7566 Aggregation-prone
13 K H -1.0721 Soluble
14 K H -2.3416 Soluble
15 P H -2.4888 Soluble
16 G H -2.3598 Soluble
17 A H -1.7751 Soluble
18 S H -1.7696 Soluble
19 V H 0.0000 Buried
20 K H -2.0121 Soluble
21 V H 0.0000 Buried
22 S H -0.6784 Soluble
23 C H 0.0000 Buried
24 K H -0.6856 Soluble
25 A H 0.0000 Buried
26 S H -0.3013 Soluble
27 G H -0.2416 Soluble
28 Y H 0.0104 Aggregation-prone
29 T H -0.0573 Soluble
30 F H 0.0000 Buried
35 T H 0.3177 Aggregation-prone
36 S H 0.0335 Aggregation-prone
37 S H 0.0711 Aggregation-prone
38 Y H 0.1452 Aggregation-prone
39 I H 0.0000 Buried
40 N H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H 0.0000 Buried
44 Q H -0.5511 Soluble
45 A H -0.8902 Soluble
46 P H -0.9372 Soluble
47 G H -1.2081 Soluble
48 Q H -1.7161 Soluble
49 G H -1.1040 Soluble
50 L H 0.0000 Buried
51 E H -0.7706 Soluble
52 W H 0.0000 Buried
53 M H 0.0000 Buried
54 G H 0.0000 Buried
55 T H 0.0000 Buried
56 I H 0.0000 Buried
57 N H -0.1031 Soluble
58 P H 0.0000 Buried
59 V H 1.4020 Aggregation-prone
62 S H 0.3934 Aggregation-prone
63 G H -0.1273 Soluble
64 S H -0.2535 Soluble
65 T H -0.3350 Soluble
66 S H -0.3013 Soluble
67 Y H -0.7461 Soluble
68 A H 0.0000 Buried
69 Q H -2.3622 Soluble
70 K H -2.7275 Soluble
71 F H 0.0000 Buried
72 Q H -2.3751 Soluble
74 G H -1.7741 Soluble
75 R H -1.6498 Soluble
76 V H 0.0000 Buried
77 T H -0.7876 Soluble
78 M H 0.0000 Buried
79 T H -0.6038 Soluble
80 R H -0.6294 Soluble
81 D H -0.7902 Soluble
82 T H 0.0197 Aggregation-prone
83 S H 0.0867 Aggregation-prone
84 I H 0.7515 Aggregation-prone
85 S H -0.0213 Soluble
86 T H 0.0000 Buried
87 A H 0.0000 Buried
88 Y H -0.7852 Soluble
89 M H 0.0000 Buried
90 E H -1.4797 Soluble
91 L H 0.0000 Buried
92 S H -1.8751 Soluble
93 R H -2.8715 Soluble
94 L H 0.0000 Buried
95 R H -3.4201 Soluble
96 S H -2.3045 Soluble
97 D H -2.2835 Soluble
98 D H 0.0000 Buried
99 T H -0.7257 Soluble
100 A H 0.0000 Buried
101 V H 0.4107 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 R H -0.1019 Soluble
107 G H -0.0256 Soluble
108 G H 0.0000 Buried
114 W H 0.3813 Aggregation-prone
115 F H 0.0000 Buried
116 D H -0.2988 Soluble
117 Y H 0.0134 Aggregation-prone
118 W H -0.3253 Soluble
119 G H 0.0000 Buried
120 Q H -1.3499 Soluble
121 G H -0.5685 Soluble
122 T H 0.0000 Buried
123 L H 0.7855 Aggregation-prone
124 V H 0.0000 Buried
125 T H -0.2249 Soluble
126 V H 0.0000 Buried
127 S H -1.0799 Soluble
2 S L -0.0626 Soluble
3 A L -0.0711 Soluble
4 L L 0.0000 Buried
5 T L -0.2955 Soluble
6 Q L -0.5595 Soluble
7 P L -0.5220 Soluble
8 A L -0.6378 Soluble
9 S L -0.8661 Soluble
11 V L -0.3881 Soluble
12 S L -0.2267 Soluble
13 G L 0.0000 Buried
14 S L 0.0022 Aggregation-prone
15 P L -0.4065 Soluble
16 G L -1.4013 Soluble
17 Q L -1.7552 Soluble
18 S L -1.1445 Soluble
19 I L 0.0000 Buried
20 T L -0.1284 Soluble
21 I L 0.0000 Buried
22 S L -0.2745 Soluble
23 C L 0.0000 Buried
24 T L -0.4718 Soluble
25 G L -0.4931 Soluble
26 T L -0.6149 Soluble
27 S L -0.6720 Soluble
28 S L -0.4547 Soluble
29 D L 0.0000 Buried
30 V L 0.0000 Buried
31 G L -0.9934 Soluble
35 S L -0.5196 Soluble
36 Y L -0.1562 Soluble
37 N L -1.2174 Soluble
38 Y L -0.0916 Soluble
39 V L 0.0000 Buried
40 N L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L -1.5599 Soluble
45 H L -1.9333 Soluble
46 P L -1.2954 Soluble
47 G L -1.4746 Soluble
48 K L -2.5070 Soluble
49 A L -1.5949 Soluble
50 P L 0.0000 Buried
51 K L -1.6282 Soluble
52 L L 0.0000 Buried
53 M L 0.0000 Buried
54 I L 0.0000 Buried
55 Y L -0.6651 Soluble
56 G L -0.7995 Soluble
57 V L 0.0000 Buried
65 S L -1.4543 Soluble
66 K L -2.1181 Soluble
67 R L -1.6282 Soluble
68 P L -1.0446 Soluble
69 S L -0.8641 Soluble
70 G L -0.7547 Soluble
71 V L -0.8262 Soluble
72 S L -0.9774 Soluble
74 N L -1.6369 Soluble
75 R L -1.1297 Soluble
76 F L 0.0000 Buried
77 S L -0.9609 Soluble
78 G L -0.7913 Soluble
79 S L -0.9661 Soluble
80 K L -1.1604 Soluble
83 S L -0.8847 Soluble
84 G L -1.0705 Soluble
85 N L -1.0467 Soluble
86 T L -0.7702 Soluble
87 A L 0.0000 Buried
88 S L -0.4426 Soluble
89 L L 0.0000 Buried
90 T L -0.2945 Soluble
91 I L 0.0000 Buried
92 S L -1.1165 Soluble
93 G L -1.1708 Soluble
94 L L 0.0000 Buried
95 Q L -1.4435 Soluble
96 A L -1.0555 Soluble
97 E L -2.3696 Soluble
98 D L 0.0000 Buried
99 E L -2.0834 Soluble
100 A L 0.0000 Buried
101 D L -1.3295 Soluble
102 Y L 0.0000 Buried
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 G L 0.0000 Buried
106 T L 0.0000 Buried
107 F L 0.6726 Aggregation-prone
108 A L 0.0000 Buried
109 G L 0.0000 Buried
110 G L -0.3016 Soluble
113 S L 0.0293 Aggregation-prone
114 Y L 0.7962 Aggregation-prone
115 Y L 0.8900 Aggregation-prone
116 G L 0.0000 Buried
117 V L 0.4916 Aggregation-prone
118 F L 0.0784 Aggregation-prone
119 G L 0.0000 Buried
120 G L -0.9248 Soluble
121 G L -0.9707 Soluble
122 T L 0.0000 Buried
123 K L -2.1321 Soluble
124 L L 0.0000 Buried
125 T L -0.3664 Soluble
126 V L 0.0000 Buried
127 L L 1.8218 Aggregation-prone
128 W L 1.8355 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.5928 4.4583 CSV PDB
4.5 -0.6116 4.4583 CSV PDB
5.0 -0.632 4.4583 CSV PDB
5.5 -0.6481 4.4583 CSV PDB
6.0 -0.6526 4.4583 CSV PDB
6.5 -0.6406 4.4583 CSV PDB
7.0 -0.6139 4.4583 CSV PDB
7.5 -0.5783 4.4583 CSV PDB
8.0 -0.5382 4.4583 CSV PDB
8.5 -0.4952 4.4583 CSV PDB
9.0 -0.4502 4.4583 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH