Xaluritamig / 8ucd

A4DAB303_8ucd_H_L | Source PDB: 8ucd | Chains: H, L | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5728
Max Score
2.095
Min Score
-3.1457
Total Score
-128.88
Score CDR
-0.0591
Score non-CDR
-0.7085

Calculation Parameters

Chain Sequence(s) QVQLVQSGAEVKKPGASVKVSCKASGYTFSTYWIEWVRQAPGQRLEWMGEILPGSGQTDFNEKFQGRVTFTADTSSDTAYMELSSLRSEDTAVYYCTRWGYYGTRGYFNVWGQGTLVTVSEIVLTQSPATLSLSPGERATLSCRASSSVSYMHWFQQKPGQAPRLLIYSTSNLASGIPARFSGSGSGTDYTLTISSLEPEDFAVYYCQQRRSFPYTFGQGTKLEI input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.1457
Maximum Score 2.095
Average Score -0.5728
Total Score -128.883

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q H -1.4001 Soluble
2 V H -0.8641 Soluble
3 Q H -1.4116 Soluble
4 L H 0.0000 Buried
5 V H -0.1538 Soluble
6 Q H -0.3544 Soluble
7 S H -0.6739 Soluble
8 G H -0.5784 Soluble
9 A H 0.1699 Aggregation-prone
11 E H -0.2064 Soluble
12 V H 0.8718 Aggregation-prone
13 K H -0.9668 Soluble
14 K H -2.0979 Soluble
15 P H -2.0582 Soluble
16 G H -1.4303 Soluble
17 A H -1.1465 Soluble
18 S H -1.2944 Soluble
19 V H 0.0000 Buried
20 K H -2.2267 Soluble
21 V H 0.0000 Buried
22 S H -0.6552 Soluble
23 C H 0.0000 Buried
24 K H -1.1641 Soluble
25 A H 0.0000 Buried
26 S H -1.0229 Soluble
27 G H -0.9234 Soluble
28 Y H -0.2222 Soluble
29 T H 0.0007 Aggregation-prone
30 F H 0.0000 Buried
35 S H -0.1912 Soluble
36 T H 0.5117 Aggregation-prone
37 Y H 1.4033 Aggregation-prone
38 W H 0.8418 Aggregation-prone
39 I H 0.0000 Buried
40 E H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H -0.3750 Soluble
44 Q H -0.7823 Soluble
45 A H -1.0459 Soluble
46 P H -0.9410 Soluble
47 G H -1.4405 Soluble
48 Q H -2.1283 Soluble
49 R H -1.8718 Soluble
50 L H 0.0000 Buried
51 E H -1.0006 Soluble
52 W H 0.0000 Buried
53 M H 0.0000 Buried
54 G H 0.0000 Buried
55 E H -0.4171 Soluble
56 I H 0.0000 Buried
57 L H -0.1127 Soluble
58 P H 0.0000 Buried
59 G H -0.9111 Soluble
62 S H -0.9660 Soluble
63 G H -1.2147 Soluble
64 Q H -1.6547 Soluble
65 T H -0.9863 Soluble
66 D H -1.0804 Soluble
67 F H -0.9523 Soluble
68 N H -1.7406 Soluble
69 E H -3.1457 Soluble
70 K H -3.0662 Soluble
71 F H 0.0000 Buried
72 Q H -2.7222 Soluble
74 G H -1.8297 Soluble
75 R H -1.6335 Soluble
76 V H 0.0000 Buried
77 T H -0.9324 Soluble
78 F H 0.0000 Buried
79 T H -0.3904 Soluble
80 A H -0.8875 Soluble
81 D H -1.5579 Soluble
82 T H -1.1585 Soluble
83 S H -0.8859 Soluble
84 S H -1.0405 Soluble
85 D H -1.4897 Soluble
86 T H 0.0000 Buried
87 A H 0.0000 Buried
88 Y H -0.7182 Soluble
89 M H 0.0000 Buried
90 E H -1.7848 Soluble
91 L H 0.0000 Buried
92 S H -1.2300 Soluble
93 S H -1.1090 Soluble
94 L H 0.0000 Buried
95 R H -2.6419 Soluble
96 S H -2.1483 Soluble
97 E H -2.3980 Soluble
98 D H 0.0000 Buried
99 T H -0.6256 Soluble
100 A H 0.0000 Buried
101 V H 0.4436 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 T H 0.0000 Buried
106 R H 0.0000 Buried
107 W H 1.0982 Aggregation-prone
108 G H 1.6977 Aggregation-prone
109 Y H 2.0950 Aggregation-prone
110 Y H 1.4510 Aggregation-prone
111 G H -0.0455 Soluble
112A T H -0.6208 Soluble
112 R H -1.1423 Soluble
113 G H 0.2610 Aggregation-prone
114 Y H 1.6352 Aggregation-prone
115 F H 1.4057 Aggregation-prone
116 N H 0.5464 Aggregation-prone
117 V H -0.0922 Soluble
118 W H -0.4044 Soluble
119 G H 0.0000 Buried
120 Q H -1.3128 Soluble
121 G H -0.4737 Soluble
122 T H 0.0000 Buried
123 L H 0.9486 Aggregation-prone
124 V H 0.0000 Buried
125 T H -0.1267 Soluble
126 V H 0.0000 Buried
127 S H -0.7745 Soluble
1 E L -1.2009 Soluble
2 I L 0.0000 Buried
3 V L 0.8257 Aggregation-prone
4 L L 0.0000 Buried
5 T L -0.6478 Soluble
6 Q L 0.0000 Buried
7 S L -0.7502 Soluble
8 P L -0.2957 Soluble
9 A L -0.4285 Soluble
10 T L -0.6617 Soluble
11 L L -0.0988 Soluble
12 S L 0.0396 Aggregation-prone
13 L L -0.2527 Soluble
14 S L -0.6308 Soluble
15 P L -1.3770 Soluble
16 G L -2.1571 Soluble
17 E L -2.8812 Soluble
18 R L -2.8381 Soluble
19 A L 0.0000 Buried
20 T L -0.5272 Soluble
21 L L 0.0000 Buried
22 S L -0.9913 Soluble
23 C L 0.0000 Buried
24 R L -2.3186 Soluble
25 A L -1.0418 Soluble
26 S L -0.6261 Soluble
27 S L -0.5822 Soluble
28 S L -0.6837 Soluble
29 V L 0.0000 Buried
37 S L -0.5302 Soluble
38 Y L -0.0487 Soluble
39 M L 0.0000 Buried
40 H L -0.1546 Soluble
41 W L 0.0000 Buried
42 F L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L -1.3002 Soluble
45 K L -1.4297 Soluble
46 P L -1.1735 Soluble
47 G L -1.4849 Soluble
48 Q L -2.2168 Soluble
49 A L -1.5458 Soluble
50 P L 0.0000 Buried
51 R L -1.9431 Soluble
52 L L -0.4065 Soluble
53 L L 0.0000 Buried
54 I L 0.0000 Buried
55 Y L 0.0000 Buried
56 S L -0.1641 Soluble
57 T L -0.4434 Soluble
65 S L -0.7205 Soluble
66 N L -0.9102 Soluble
67 L L 0.0424 Aggregation-prone
68 A L -0.2390 Soluble
69 S L -0.4254 Soluble
70 G L -0.3759 Soluble
71 I L 0.0527 Aggregation-prone
72 P L -0.1315 Soluble
74 A L -0.0929 Soluble
75 R L -0.7135 Soluble
76 F L 0.0000 Buried
77 S L -0.4463 Soluble
78 G L -0.5263 Soluble
79 S L -0.8592 Soluble
80 G L -1.0270 Soluble
83 S L -1.0200 Soluble
84 G L -1.3013 Soluble
85 T L -1.7065 Soluble
86 D L -2.4874 Soluble
87 Y L 0.0000 Buried
88 T L -0.8677 Soluble
89 L L 0.0000 Buried
90 T L -0.6378 Soluble
91 I L 0.0000 Buried
92 S L -1.5793 Soluble
93 S L -1.8416 Soluble
94 L L 0.0000 Buried
95 E L -2.3057 Soluble
96 P L -1.5347 Soluble
97 E L -2.1966 Soluble
98 D L 0.0000 Buried
99 F L -0.4967 Soluble
100 A L 0.0000 Buried
101 V L -0.6223 Soluble
102 Y L 0.0000 Buried
103 Y L -0.5072 Soluble
104 C L 0.0000 Buried
105 Q L 0.0000 Buried
106 Q L 0.0000 Buried
107 R L -0.8600 Soluble
108 R L -1.6313 Soluble
109 S L -0.7565 Soluble
114 F L 0.5192 Aggregation-prone
115 P L -0.3848 Soluble
116 Y L -0.1072 Soluble
117 T L -0.2500 Soluble
118 F L 0.0000 Buried
119 G L 0.0000 Buried
120 Q L -1.6147 Soluble
121 G L -1.1375 Soluble
122 T L 0.0000 Buried
123 K L -1.4433 Soluble
124 L L 0.0000 Buried
125 E L -0.4718 Soluble
126 I L 1.3709 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.5321 2.9319 CSV PDB
4.5 -0.5635 2.821 CSV PDB
5.0 -0.6075 2.6734 CSV PDB
5.5 -0.6552 2.5137 CSV PDB
6.0 -0.697 2.3672 CSV PDB
6.5 -0.7243 2.3672 CSV PDB
7.0 -0.7329 2.3671 CSV PDB
7.5 -0.7269 2.367 CSV PDB
8.0 -0.7133 2.3665 CSV PDB
8.5 -0.6965 2.3651 CSV PDB
9.0 -0.6778 2.3607 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH