Utomilumab / 6a3w

A4DAB286_6a3w_G_H | Source PDB: 6a3w | Chains: G, H | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5772
Max Score
1.5652
Min Score
-3.464
Total Score
-128.72
Score CDR
-0.1768
Score non-CDR
-0.6784

Calculation Parameters

Chain Sequence(s) EVQLVQSGAEVKKPGESLRISCKGSGYSFSTYWISWVRQMPGKGLEWMGKIYPGDSYTNYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARGYGIFDYWGQGTLVTVSSYELTQPPSVSVSPGQTASITCSGDNIGDQYAHWYQQKPGQSPVLVIYQDKNRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCATYTGFGSLAVFGGGTKLTVL input.pdb
Selected Chain(s) G (Heavy), H (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.464
Maximum Score 1.5652
Average Score -0.5772
Total Score -128.7151

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E G -2.1001 Soluble
2 V G -1.1979 Soluble
3 Q G -1.3827 Soluble
4 L G 0.0000 Buried
5 V G 0.0366 Aggregation-prone
6 Q G 0.0000 Buried
7 S G -0.5419 Soluble
8 G G -0.4913 Soluble
9 A G 0.2562 Aggregation-prone
11 E G 0.1430 Aggregation-prone
12 V G 1.1022 Aggregation-prone
13 K G -0.9858 Soluble
14 K G -2.3562 Soluble
15 P G -2.2620 Soluble
16 G G -1.9726 Soluble
17 E G -2.1480 Soluble
18 S G -1.8263 Soluble
19 L G 0.0000 Buried
20 R G -2.1639 Soluble
21 I G 0.0000 Buried
22 S G -0.6055 Soluble
23 C G 0.0000 Buried
24 K G -0.7268 Soluble
25 G G 0.0000 Buried
26 S G -0.8086 Soluble
27 G G -1.2070 Soluble
28 Y G -0.4552 Soluble
29 S G -0.3184 Soluble
30 F G 0.0000 Buried
35 S G -0.7932 Soluble
36 T G -0.0786 Soluble
37 Y G 0.9291 Aggregation-prone
38 W G 1.0242 Aggregation-prone
39 I G 0.0000 Buried
40 S G 0.0000 Buried
41 W G 0.0000 Buried
42 V G 0.0000 Buried
43 R G -0.6053 Soluble
44 Q G -0.8035 Soluble
45 M G -0.7629 Soluble
46 P G -0.8945 Soluble
47 G G -1.4182 Soluble
48 K G -2.2154 Soluble
49 G G -1.4841 Soluble
50 L G 0.0000 Buried
51 E G -0.9372 Soluble
52 W G 0.0000 Buried
53 M G 0.0000 Buried
54 G G 0.0000 Buried
55 K G 0.0000 Buried
56 I G 0.0000 Buried
57 Y G 0.3526 Aggregation-prone
58 P G 0.0000 Buried
59 G G -1.1496 Soluble
62 D G -1.6737 Soluble
63 S G -0.6923 Soluble
64 Y G 0.7600 Aggregation-prone
65 T G 0.4226 Aggregation-prone
66 N G -0.0118 Soluble
67 Y G -0.5609 Soluble
68 S G -0.5494 Soluble
69 P G -0.9039 Soluble
70 S G -0.9227 Soluble
71 F G 0.0000 Buried
72 Q G -1.8059 Soluble
74 G G -1.5218 Soluble
75 Q G -1.5886 Soluble
76 V G 0.0000 Buried
77 T G -0.8798 Soluble
78 I G 0.0000 Buried
79 S G -0.4664 Soluble
80 A G -0.9273 Soluble
81 D G -1.5052 Soluble
82 K G -2.1836 Soluble
83 S G -0.6747 Soluble
84 I G 0.2915 Aggregation-prone
85 S G -0.6691 Soluble
86 T G 0.0000 Buried
87 A G 0.0000 Buried
88 Y G -0.7094 Soluble
89 L G 0.0000 Buried
90 Q G -1.4739 Soluble
91 W G 0.0000 Buried
92 S G -1.3634 Soluble
93 S G -1.6457 Soluble
94 L G 0.0000 Buried
95 K G -2.4565 Soluble
96 A G -1.3666 Soluble
97 S G -0.6692 Soluble
98 D G 0.0000 Buried
99 T G -0.1222 Soluble
100 A G 0.0000 Buried
101 M G 0.3056 Aggregation-prone
102 Y G 0.0000 Buried
103 Y G 0.0000 Buried
104 C G 0.0000 Buried
105 A G 0.0000 Buried
106 R G 0.0000 Buried
107 G G 0.6887 Aggregation-prone
108 Y G 1.3134 Aggregation-prone
109 G G 0.0000 Buried
114 I G 0.8529 Aggregation-prone
115 F G 0.0000 Buried
116 D G -0.7304 Soluble
117 Y G -0.3385 Soluble
118 W G -0.1912 Soluble
119 G G 0.0000 Buried
120 Q G -1.2850 Soluble
121 G G -0.5531 Soluble
122 T G 0.0000 Buried
123 L G 0.7615 Aggregation-prone
124 V G 0.0000 Buried
125 T G 0.1273 Aggregation-prone
126 V G 0.0000 Buried
127 S G -0.9127 Soluble
128 S G -1.1456 Soluble
2 Y H -0.1431 Soluble
3 E H -1.6782 Soluble
4 L H 0.0000 Buried
5 T H -0.7527 Soluble
6 Q H 0.0000 Buried
7 P H -0.5970 Soluble
8 P H -0.9846 Soluble
9 S H -1.0561 Soluble
11 V H -0.6902 Soluble
12 S H -0.3949 Soluble
13 V H 0.0000 Buried
14 S H -0.3253 Soluble
15 P H -0.7933 Soluble
16 G H -1.5391 Soluble
17 Q H -1.8296 Soluble
18 T H -1.1459 Soluble
19 A H 0.0000 Buried
20 S H -0.4005 Soluble
21 I H 0.0000 Buried
22 T H -0.1832 Soluble
23 C H 0.0000 Buried
24 S H -1.5116 Soluble
25 G H -2.1343 Soluble
26 D H -3.3364 Soluble
27 N H -3.4640 Soluble
28 I H 0.0000 Buried
29 G H -2.3464 Soluble
36 D H -2.6453 Soluble
37 Q H -0.8851 Soluble
38 Y H 0.5518 Aggregation-prone
39 A H 0.0000 Buried
40 H H 0.0000 Buried
41 W H 0.0000 Buried
42 Y H 0.0000 Buried
43 Q H 0.0000 Buried
44 Q H 0.0000 Buried
45 K H -1.6800 Soluble
46 P H -1.4434 Soluble
47 G H -1.5191 Soluble
48 Q H -1.8722 Soluble
49 S H -0.9453 Soluble
50 P H 0.0000 Buried
51 V H 0.5666 Aggregation-prone
52 L H 0.4387 Aggregation-prone
53 V H 0.0000 Buried
54 I H 0.0000 Buried
55 Y H -0.4318 Soluble
56 Q H -0.5448 Soluble
57 D H -1.1691 Soluble
65 K H -2.2097 Soluble
66 N H -1.7357 Soluble
67 R H -1.8964 Soluble
68 P H -1.1364 Soluble
69 S H -0.8930 Soluble
70 G H -0.8642 Soluble
71 I H -0.6724 Soluble
72 P H -1.2645 Soluble
74 E H -2.2618 Soluble
75 R H -1.5390 Soluble
76 F H 0.0000 Buried
77 S H -1.3732 Soluble
78 G H -1.2702 Soluble
79 S H -1.0232 Soluble
80 N H -1.4115 Soluble
83 S H -1.5738 Soluble
84 G H -2.3762 Soluble
85 N H -2.9836 Soluble
86 T H -1.5170 Soluble
87 A H 0.0000 Buried
88 T H -0.5274 Soluble
89 L H 0.0000 Buried
90 T H -0.3367 Soluble
91 I H 0.0000 Buried
92 S H -1.2208 Soluble
93 G H -1.2878 Soluble
94 T H 0.0000 Buried
95 Q H -1.0703 Soluble
96 A H -0.1098 Soluble
97 M H 0.3116 Aggregation-prone
98 D H 0.0000 Buried
99 E H -1.3761 Soluble
100 A H 0.0000 Buried
101 D H -1.9225 Soluble
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 T H 0.0000 Buried
107 Y H 1.1290 Aggregation-prone
108 T H 0.9471 Aggregation-prone
109 G H 0.4414 Aggregation-prone
110 F H 1.5652 Aggregation-prone
113 G H 0.4101 Aggregation-prone
114 S H 0.4760 Aggregation-prone
115 L H 0.7717 Aggregation-prone
116 A H 0.0000 Buried
117 V H 0.1106 Aggregation-prone
118 F H 0.0000 Buried
119 G H 0.0000 Buried
120 G H -1.2343 Soluble
121 G H -1.2445 Soluble
122 T H 0.0000 Buried
123 K H -2.3588 Soluble
124 L H 0.0000 Buried
125 T H -0.6756 Soluble
126 V H 0.0000 Buried
127 L H 1.1998 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.4706 4.2346 CSV PDB
4.5 -0.51 4.2346 CSV PDB
5.0 -0.554 4.2346 CSV PDB
5.5 -0.5942 4.2346 CSV PDB
6.0 -0.6215 4.2346 CSV PDB
6.5 -0.6297 4.2346 CSV PDB
7.0 -0.6194 4.2346 CSV PDB
7.5 -0.5971 4.2346 CSV PDB
8.0 -0.5673 4.2346 CSV PDB
8.5 -0.5313 4.2346 CSV PDB
9.0 -0.4896 4.2345 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH