Odesivimab / 7tn9

A4DAB187_7tn9_O_P | Source PDB: 7tn9 | Chains: O, P | Done
73.44
Yes
10 Å
Yes
Avg A4D Score
-0.5058
Max Score
1.5661
Min Score
-2.6637
Total Score
-109.25
Score CDR
-0.0952
Score non-CDR
-0.6108

Calculation Parameters

Chain Sequence(s) VQLVESGGGLVQPGGSLRLSCAASGFTSSSYAMNWVRQAPGKGLEWVSTISGMGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKRGYPHSFDIWGQGTMVTVDIQMTQSPSSLSASVGDRVTITCRASQSISSFLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTLTFGQGT input.pdb
Selected Chain(s) O (Heavy), P (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.6637
Maximum Score 1.5661
Average Score -0.5058
Total Score -109.2511

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V O 1.1840 Aggregation-prone
3 Q O -0.3419 Soluble
4 L O 0.0000 Buried
5 V O 0.1722 Aggregation-prone
6 E O -0.3459 Soluble
7 S O -0.7765 Soluble
8 G O -0.9182 Soluble
9 G O -0.3663 Soluble
11 G O 0.5041 Aggregation-prone
12 L O 1.5661 Aggregation-prone
13 V O 0.3403 Aggregation-prone
14 Q O -0.8713 Soluble
15 P O -1.2147 Soluble
16 G O -1.3022 Soluble
17 G O -1.3788 Soluble
18 S O -1.7214 Soluble
19 L O -1.2772 Soluble
20 R O -2.3833 Soluble
21 L O 0.0000 Buried
22 S O -0.6516 Soluble
23 C O 0.0000 Buried
24 A O -0.4125 Soluble
25 A O -0.2257 Soluble
26 S O -0.1433 Soluble
27 G O -0.1156 Soluble
28 F O 0.3157 Aggregation-prone
29 T O -0.2446 Soluble
30 S O 0.0000 Buried
35 S O -0.6009 Soluble
36 S O 0.1030 Aggregation-prone
37 Y O 0.4574 Aggregation-prone
38 A O -0.1366 Soluble
39 M O 0.0000 Buried
40 N O 0.0000 Buried
41 W O 0.0000 Buried
42 V O 0.0000 Buried
43 R O 0.0000 Buried
44 Q O -0.7571 Soluble
45 A O -1.2108 Soluble
46 P O -0.8695 Soluble
47 G O -1.4324 Soluble
48 K O -2.3356 Soluble
49 G O -1.5461 Soluble
50 L O 0.0000 Buried
51 E O -1.2701 Soluble
52 W O -0.5385 Soluble
53 V O 0.0000 Buried
54 S O 0.0000 Buried
55 T O 0.3783 Aggregation-prone
56 I O 0.0000 Buried
57 S O 0.1429 Aggregation-prone
58 G O 0.0976 Aggregation-prone
59 M O 0.5522 Aggregation-prone
62 G O -0.2234 Soluble
63 G O -0.2265 Soluble
64 S O 0.0559 Aggregation-prone
65 T O 0.3792 Aggregation-prone
66 Y O 0.8943 Aggregation-prone
67 Y O -0.2141 Soluble
68 A O 0.0000 Buried
69 D O -2.3711 Soluble
70 S O -1.6528 Soluble
71 V O 0.0000 Buried
72 K O -2.4507 Soluble
74 G O -1.8949 Soluble
75 R O -1.7452 Soluble
76 F O 0.0000 Buried
77 T O -0.9526 Soluble
78 I O 0.0000 Buried
79 S O -0.7586 Soluble
80 R O -0.9298 Soluble
81 D O -1.5507 Soluble
82 N O -2.0886 Soluble
83 S O -1.8657 Soluble
84 K O -2.4332 Soluble
85 N O -1.8036 Soluble
86 T O -1.1138 Soluble
87 L O 0.0000 Buried
88 Y O -0.6552 Soluble
89 L O 0.0000 Buried
90 Q O -1.7427 Soluble
91 M O 0.0000 Buried
92 N O -2.2533 Soluble
93 S O -1.4426 Soluble
94 L O 0.0000 Buried
95 R O -2.2883 Soluble
96 A O -1.4462 Soluble
97 E O -2.0891 Soluble
98 D O 0.0000 Buried
99 T O -0.2284 Soluble
100 A O 0.0000 Buried
101 V O 0.0755 Aggregation-prone
102 Y O 0.0000 Buried
103 Y O 0.0000 Buried
104 C O 0.0000 Buried
105 A O 0.0000 Buried
106 K O -0.6619 Soluble
107 R O -1.0232 Soluble
108 G O -0.1758 Soluble
109 Y O 0.8904 Aggregation-prone
110 P O 0.0000 Buried
113 H O -0.5040 Soluble
114 S O 0.0000 Buried
115 F O 0.0000 Buried
116 D O -0.8216 Soluble
117 I O -0.3672 Soluble
118 W O 0.0000 Buried
119 G O 0.0000 Buried
120 Q O -1.5839 Soluble
121 G O -0.9299 Soluble
122 T O -0.2627 Soluble
123 M O 0.4015 Aggregation-prone
124 V O 0.0000 Buried
125 T O 0.7615 Aggregation-prone
126 V O 0.4417 Aggregation-prone
1 D P -2.2187 Soluble
2 I P -1.5116 Soluble
3 Q P -1.9917 Soluble
4 M P 0.0000 Buried
5 T P -1.0646 Soluble
6 Q P 0.0000 Buried
7 S P -0.6979 Soluble
8 P P -0.4178 Soluble
9 S P -0.5266 Soluble
10 S P -0.3212 Soluble
11 L P 0.2005 Aggregation-prone
12 S P 0.2085 Aggregation-prone
13 A P -0.1583 Soluble
14 S P -0.0655 Soluble
15 V P 0.4475 Aggregation-prone
16 G P -1.0714 Soluble
17 D P -2.3814 Soluble
18 R P -2.3057 Soluble
19 V P -0.8792 Soluble
20 T P -0.4825 Soluble
21 I P 0.0000 Buried
22 T P -0.5293 Soluble
23 C P 0.0000 Buried
24 R P -1.9042 Soluble
25 A P 0.0000 Buried
26 S P -1.6742 Soluble
27 Q P -1.9613 Soluble
28 S P -1.0003 Soluble
29 I P 0.0000 Buried
36 S P -0.2485 Soluble
37 S P -0.0983 Soluble
38 F P 0.7553 Aggregation-prone
39 L P 0.0000 Buried
40 N P 0.0000 Buried
41 W P 0.0000 Buried
42 Y P 0.0000 Buried
43 Q P 0.0000 Buried
44 Q P 0.0000 Buried
45 K P -1.7343 Soluble
46 P P -1.3195 Soluble
47 G P -1.7378 Soluble
48 K P -2.6637 Soluble
49 A P -1.7947 Soluble
50 P P 0.0000 Buried
51 K P -1.6868 Soluble
52 L P 0.0000 Buried
53 L P 0.0000 Buried
54 I P 0.0000 Buried
55 Y P 0.5198 Aggregation-prone
56 A P 0.3281 Aggregation-prone
57 A P 0.0000 Buried
65 S P -0.2833 Soluble
66 S P 0.0092 Aggregation-prone
67 L P 0.2337 Aggregation-prone
68 Q P -0.3504 Soluble
69 S P -0.4362 Soluble
70 G P -0.5113 Soluble
71 V P -0.3434 Soluble
72 P P -0.3393 Soluble
74 S P -0.4209 Soluble
75 R P -0.7384 Soluble
76 F P 0.0000 Buried
77 S P -0.3198 Soluble
78 G P -0.2845 Soluble
79 S P -0.6217 Soluble
80 G P -0.8238 Soluble
83 S P -0.9011 Soluble
84 G P -0.9704 Soluble
85 T P -1.2651 Soluble
86 D P -1.4928 Soluble
87 F P 0.0000 Buried
88 T P -0.5891 Soluble
89 L P 0.0000 Buried
90 T P -0.4746 Soluble
91 I P 0.0000 Buried
92 S P -1.4973 Soluble
93 S P -1.4613 Soluble
94 L P 0.0000 Buried
95 Q P -0.9693 Soluble
96 P P -0.7548 Soluble
97 E P -1.6741 Soluble
98 D P 0.0000 Buried
99 F P 0.5491 Aggregation-prone
100 A P 0.0000 Buried
101 T P -0.0555 Soluble
102 Y P 0.0000 Buried
103 Y P 0.0000 Buried
104 C P 0.0000 Buried
105 Q P 0.0000 Buried
106 Q P 0.0000 Buried
107 S P 0.0000 Buried
108 Y P 0.9735 Aggregation-prone
114 S P 0.0877 Aggregation-prone
115 T P -0.3061 Soluble
116 L P 0.1827 Aggregation-prone
117 T P -0.5094 Soluble
118 F P 0.0000 Buried
119 G P 0.0000 Buried
120 Q P -1.3974 Soluble
121 G P -0.8223 Soluble
122 T P -0.2600 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.5744 2.4388 CSV PDB
4.5 -0.6033 2.3266 CSV PDB
5.0 -0.6348 2.3057 CSV PDB
5.5 -0.6633 2.3057 CSV PDB
6.0 -0.6827 2.3057 CSV PDB
6.5 -0.689 2.3057 CSV PDB
7.0 -0.684 2.3057 CSV PDB
7.5 -0.6729 2.3057 CSV PDB
8.0 -0.6587 2.3057 CSV PDB
8.5 -0.6412 2.3057 CSV PDB
9.0 -0.6193 2.3057 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH