Sipavibart / 8cbf

A4DAB241_8cbf_H_L | Source PDB: 8cbf | Chains: H, L | Done
98.29
Yes
10 Å
Yes
Avg A4D Score
-0.6634
Max Score
1.6563
Min Score
-3.1466
Total Score
-285.92
Score CDR
-0.4583
Score non-CDR
-0.6934

Calculation Parameters

Chain Sequence(s) EVQLLETGGGLVQPGRSLRLSCAASGFPFDDYAIHWVRLAPGKGLEWVSSISWDSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGAFPGYSSGWYYGLDVWGQGATVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSVVTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIFEVSKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGNKGVFGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.1466
Maximum Score 1.6563
Average Score -0.6634
Total Score -285.919

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E H -2.0355 Soluble
2 V H -1.1077 Soluble
3 Q H -1.1390 Soluble
4 L H 0.0000 Buried
5 L H 0.4087 Aggregation-prone
6 E H -0.0372 Soluble
7 T H -0.4160 Soluble
8 G H -0.7409 Soluble
9 G H -0.7997 Soluble
11 G H -0.6962 Soluble
12 L H -0.2922 Soluble
13 V H 0.0000 Buried
14 Q H -1.8286 Soluble
15 P H -2.2397 Soluble
16 G H -2.3262 Soluble
17 R H -2.8301 Soluble
18 S H -1.8737 Soluble
19 L H -1.3167 Soluble
20 R H -1.7187 Soluble
21 L H 0.0000 Buried
22 S H -0.3926 Soluble
23 C H 0.0000 Buried
24 A H -0.2365 Soluble
25 A H 0.0000 Buried
26 S H -0.8904 Soluble
27 G H -1.2220 Soluble
28 F H -0.9884 Soluble
29 P H -1.3126 Soluble
30 F H 0.0000 Buried
35 D H -3.1466 Soluble
36 D H -2.3144 Soluble
37 Y H 0.0000 Buried
38 A H 0.0000 Buried
39 I H 0.0000 Buried
40 H H 0.0000 Buried
41 W H 0.0000 Buried
42 V H 0.0000 Buried
43 R H 0.0000 Buried
44 L H -0.3078 Soluble
45 A H 0.0000 Buried
46 P H -1.1366 Soluble
47 G H -1.3958 Soluble
48 K H -2.1459 Soluble
49 G H -1.2541 Soluble
50 L H 0.0000 Buried
51 E H -0.8155 Soluble
52 W H 0.0000 Buried
53 V H 0.0000 Buried
54 S H 0.0000 Buried
55 S H 0.0000 Buried
56 I H 0.0000 Buried
57 S H 0.0000 Buried
58 W H -1.7227 Soluble
59 D H -2.3928 Soluble
62 S H -1.0176 Soluble
63 G H -0.8121 Soluble
64 S H -0.2041 Soluble
65 I H 0.5524 Aggregation-prone
66 G H -0.3127 Soluble
67 Y H -0.9194 Soluble
68 A H -1.5464 Soluble
69 D H -2.4915 Soluble
70 S H -1.8091 Soluble
71 V H 0.0000 Buried
72 K H -2.6379 Soluble
74 G H -1.8110 Soluble
75 R H -1.6131 Soluble
76 F H 0.0000 Buried
77 T H -0.6711 Soluble
78 I H 0.0000 Buried
79 S H -0.4188 Soluble
80 R H -1.2441 Soluble
81 D H -1.7217 Soluble
82 N H -2.2840 Soluble
83 A H -1.5297 Soluble
84 K H -2.3553 Soluble
85 N H -1.9562 Soluble
86 S H -1.1726 Soluble
87 L H 0.0000 Buried
88 Y H -0.4736 Soluble
89 L H 0.0000 Buried
90 Q H -1.0962 Soluble
91 M H 0.0000 Buried
92 N H -1.9994 Soluble
93 S H -1.9857 Soluble
94 L H 0.0000 Buried
95 R H -3.0493 Soluble
96 A H -1.9364 Soluble
97 E H -2.4344 Soluble
98 D H 0.0000 Buried
99 T H -0.8275 Soluble
100 A H 0.0000 Buried
101 L H 0.1866 Aggregation-prone
102 Y H 0.0000 Buried
103 Y H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 K H 0.0000 Buried
107 G H 0.0000 Buried
108 A H 0.8382 Aggregation-prone
109 F H 1.5194 Aggregation-prone
110 P H 0.1301 Aggregation-prone
111 G H 0.2004 Aggregation-prone
111A Y H -0.0006 Soluble
111B S H -0.1653 Soluble
112C S H 0.0000 Buried
112B G H 0.0000 Buried
112A W H 0.0000 Buried
112 Y H 0.6668 Aggregation-prone
113 Y H 0.5838 Aggregation-prone
114 G H 0.0000 Buried
115 L H 0.0000 Buried
116 D H -0.5336 Soluble
117 V H -0.4183 Soluble
118 W H 0.0000 Buried
119 G H 0.0000 Buried
120 Q H -1.3277 Soluble
121 G H 0.0000 Buried
122 A H 0.0000 Buried
123 T H -0.2509 Soluble
124 V H 0.0000 Buried
125 T H -0.5849 Soluble
126 V H 0.0000 Buried
127 S H -0.7067 Soluble
128 S H -0.5743 Soluble
129 A H -0.3741 Soluble
130 S H -0.4930 Soluble
131 T H -0.6008 Soluble
132 K H -1.0146 Soluble
133 G H -1.2431 Soluble
134 P H -0.5589 Soluble
135 S H -0.3058 Soluble
136 V H 0.0000 Buried
137 F H 0.0000 Buried
138 P H 0.0000 Buried
139 L H 0.0000 Buried
140 A H -1.3048 Soluble
141 P H 0.0000 Buried
142 S H -0.7704 Soluble
143 G H -0.6282 Soluble
144 T H -0.4450 Soluble
145 A H -0.2611 Soluble
146 A H -0.1055 Soluble
147 L H 0.0000 Buried
148 G H 0.0000 Buried
149 C H 0.0000 Buried
150 L H 0.0000 Buried
151 V H 0.0000 Buried
152 K H -0.3340 Soluble
153 D H -0.3599 Soluble
154 Y H 0.0000 Buried
155 F H -0.1496 Soluble
156 P H 0.0000 Buried
157 E H -0.5707 Soluble
158 P H -0.7435 Soluble
159 V H -0.6100 Soluble
160 T H -0.5356 Soluble
161 V H -0.3307 Soluble
162 S H -0.3770 Soluble
163 W H 0.0000 Buried
164 N H -0.7691 Soluble
165 S H -0.6432 Soluble
166 G H -0.4111 Soluble
167 A H -0.2119 Soluble
168 L H -0.0269 Soluble
169 T H -0.2133 Soluble
170 S H -0.2951 Soluble
171 G H -0.4037 Soluble
172 V H 0.0446 Aggregation-prone
173 H H -0.2563 Soluble
174 T H -0.0727 Soluble
175 F H 0.0000 Buried
176 P H -0.0502 Soluble
177 A H 0.2665 Aggregation-prone
178 V H 0.0000 Buried
179 L H 1.3037 Aggregation-prone
180 Q H 0.3935 Aggregation-prone
181 S H -0.0459 Soluble
182 S H -0.1691 Soluble
183 G H 0.1115 Aggregation-prone
184 L H 0.2149 Aggregation-prone
185 Y H 0.4238 Aggregation-prone
186 S H 0.0000 Buried
187 L H 0.0000 Buried
189 S H 0.0000 Buried
190 V H 0.0000 Buried
191 V H 0.0000 Buried
192 T H -0.2384 Soluble
193 V H 0.0000 Buried
194 P H -0.4848 Soluble
195 S H -0.5165 Soluble
196 S H -0.5535 Soluble
197 S H -0.5123 Soluble
198 L H -0.7213 Soluble
199 G H -0.9319 Soluble
200 T H -0.6379 Soluble
201 Q H -1.0508 Soluble
202 T H -1.0884 Soluble
203 Y H 0.0000 Buried
204 I H -1.4136 Soluble
205 C H 0.0000 Buried
206 N H -1.4661 Soluble
207 V H 0.0000 Buried
208 N H -1.7327 Soluble
209 H H 0.0000 Buried
210 K H -2.7138 Soluble
211 P H -1.5684 Soluble
212 S H -1.7456 Soluble
213 N H -2.5272 Soluble
214 T H -2.0093 Soluble
215 K H -2.6309 Soluble
216 V H -1.7289 Soluble
217 D H -2.6137 Soluble
218 K H -2.3440 Soluble
219 R H -2.7563 Soluble
220 V H 0.0000 Buried
221 E H -2.8547 Soluble
222 P H -1.9000 Soluble
223 K H -2.2644 Soluble
2 S L 0.2908 Aggregation-prone
3 V L 1.6563 Aggregation-prone
4 V L 0.0000 Buried
5 T L 0.1865 Aggregation-prone
6 Q L 0.0000 Buried
7 P L -0.6316 Soluble
8 P L -0.9236 Soluble
9 S L -1.0869 Soluble
11 A L -0.7274 Soluble
12 S L -0.1654 Soluble
13 G L -0.2290 Soluble
14 S L -0.2027 Soluble
15 L L -0.2182 Soluble
16 G L -1.0311 Soluble
17 Q L -1.4628 Soluble
18 S L -1.0343 Soluble
19 V L 0.0000 Buried
20 T L -0.1983 Soluble
21 I L 0.0000 Buried
22 S L -0.2277 Soluble
23 C L 0.0000 Buried
24 T L -0.2415 Soluble
25 G L 0.0000 Buried
26 T L -0.3221 Soluble
27 S L -0.7555 Soluble
28 S L -0.5423 Soluble
29 D L 0.0000 Buried
30 V L 0.0000 Buried
31 G L -1.1140 Soluble
35 G L -0.8142 Soluble
36 Y L -0.5574 Soluble
37 N L -1.1512 Soluble
38 Y L -0.1036 Soluble
39 V L 0.0000 Buried
40 S L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L 0.0000 Buried
45 H L -1.1387 Soluble
46 P L -1.0227 Soluble
47 G L -1.4095 Soluble
48 K L -1.9034 Soluble
49 A L -1.2582 Soluble
50 P L 0.0000 Buried
51 K L -1.3230 Soluble
52 L L 0.0000 Buried
53 M L 0.0000 Buried
54 I L 0.0000 Buried
55 F L -0.6657 Soluble
56 E L -1.0743 Soluble
57 V L -0.9129 Soluble
65 S L -1.4266 Soluble
66 K L -2.0750 Soluble
67 R L -1.7408 Soluble
68 P L -0.8988 Soluble
69 S L -0.7694 Soluble
70 G L -0.8979 Soluble
71 V L 0.0000 Buried
72 P L -1.3564 Soluble
74 D L -2.1970 Soluble
75 R L -1.4247 Soluble
76 F L 0.0000 Buried
77 S L -1.1204 Soluble
78 G L 0.0000 Buried
79 S L -0.8656 Soluble
80 K L -1.0376 Soluble
83 S L -0.8223 Soluble
84 G L -1.0673 Soluble
85 N L -1.1572 Soluble
86 T L -0.7489 Soluble
87 A L 0.0000 Buried
88 S L -0.3048 Soluble
89 L L 0.0000 Buried
90 T L -0.2703 Soluble
91 V L 0.0000 Buried
92 S L -1.1584 Soluble
93 G L -1.2162 Soluble
94 L L 0.0000 Buried
95 Q L -1.0994 Soluble
96 A L -0.9266 Soluble
97 E L -1.7051 Soluble
98 D L 0.0000 Buried
99 E L 0.0000 Buried
100 A L 0.0000 Buried
101 D L 0.0000 Buried
102 Y L 0.0000 Buried
103 Y L 0.0000 Buried
104 C L 0.0000 Buried
105 S L 0.0000 Buried
106 S L 0.0000 Buried
107 Y L -0.3413 Soluble
108 A L -0.6805 Soluble
109 G L -1.1057 Soluble
114 N L -1.6383 Soluble
115 K L -1.4410 Soluble
116 G L 0.0000 Buried
117 V L 0.2142 Aggregation-prone
118 F L 0.0000 Buried
119 G L 0.0000 Buried
120 G L -0.5424 Soluble
121 G L -0.9993 Soluble
122 T L 0.0000 Buried
123 K L -1.9033 Soluble
124 L L 0.0000 Buried
125 T L -0.1693 Soluble
126 V L 0.0000 Buried
127 L L 0.8834 Aggregation-prone
128 G L -0.2526 Soluble
129 Q L -0.4776 Soluble
130 P L -1.2251 Soluble
131 K L -2.5209 Soluble
132 A L -2.0233 Soluble
133 N L -2.1636 Soluble
134 P L 0.0000 Buried
135 T L -0.5623 Soluble
136 V L 0.0000 Buried
137 T L -0.4286 Soluble
138 L L 0.0000 Buried
139 F L 0.0000 Buried
140 P L -0.0643 Soluble
141 P L 0.0000 Buried
142 S L -0.9763 Soluble
143 S L -1.3817 Soluble
144 E L -1.9615 Soluble
145 E L 0.0000 Buried
146 L L -1.7995 Soluble
147 Q L -2.1594 Soluble
148 A L -1.7771 Soluble
149 N L -2.4995 Soluble
150 K L -2.3475 Soluble
151 A L 0.0000 Buried
152 T L 0.0000 Buried
153 L L 0.0000 Buried
154 V L 0.0000 Buried
155 C L 0.0000 Buried
156 L L 0.0000 Buried
157 I L 0.0000 Buried
158 S L -0.8202 Soluble
159 D L -1.5981 Soluble
160 F L 0.0000 Buried
161 Y L 0.0000 Buried
162 P L -1.0011 Soluble
163 G L -0.5659 Soluble
164 A L -0.2013 Soluble
165 V L -0.2091 Soluble
166 T L -0.0784 Soluble
167 V L 0.1813 Aggregation-prone
168 A L -0.3372 Soluble
169 W L 0.0000 Buried
170 K L -1.0793 Soluble
171 A L 0.0000 Buried
172 D L -1.2909 Soluble
173 S L -0.8786 Soluble
174 S L -0.7802 Soluble
175 P L -0.8825 Soluble
176 V L -0.8032 Soluble
177 K L -1.5826 Soluble
178 A L -0.6738 Soluble
179 G L -0.3393 Soluble
180 V L 0.0816 Aggregation-prone
181 E L 0.0871 Aggregation-prone
182 T L 0.1814 Aggregation-prone
183 T L 0.0854 Aggregation-prone
184 T L 0.0729 Aggregation-prone
185 P L -0.1864 Soluble
186 S L -0.3990 Soluble
187 K L -0.9764 Soluble
188 Q L -1.1570 Soluble
189 S L -1.4079 Soluble
190 N L -1.6457 Soluble
191 N L -1.5075 Soluble
192 K L -1.4042 Soluble
193 Y L -0.6818 Soluble
194 A L 0.0000 Buried
195 A L 0.0000 Buried
196 S L 0.0000 Buried
197 S L 0.0000 Buried
198 Y L 0.0000 Buried
199 L L 0.0000 Buried
200 S L -0.3912 Soluble
201 L L -1.0127 Soluble
202 T L -1.7651 Soluble
203 P L -2.3869 Soluble
204 E L -3.1194 Soluble
205 Q L -2.3667 Soluble
206 W L 0.0000 Buried
207 K L -3.1236 Soluble
208 S L -2.4566 Soluble
209 H L -2.3959 Soluble
210 R L -2.7609 Soluble
211 S L -1.7568 Soluble
212 Y L 0.0000 Buried
213 S L 0.0000 Buried
214 C L 0.0000 Buried
215 Q L -1.0264 Soluble
216 V L 0.0000 Buried
217 T L -0.8211 Soluble
218 H L 0.0000 Buried
219 E L -2.5176 Soluble
220 G L -1.3903 Soluble
221 S L -0.9986 Soluble
222 T L -0.9119 Soluble
223 V L -0.9585 Soluble
224 E L -2.1684 Soluble
225 K L -1.6899 Soluble
226 T L -0.9505 Soluble
227 V L -0.6967 Soluble
228 A L -1.4788 Soluble
229 P L -1.5926 Soluble
230 T L -1.5503 Soluble
231 E L -2.0758 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6098 4.7153 CSV PDB
4.5 -0.648 4.6728 CSV PDB
5.0 -0.6922 4.6216 CSV PDB
5.5 -0.734 4.5667 CSV PDB
6.0 -0.7634 4.5103 CSV PDB
6.5 -0.7724 4.4536 CSV PDB
7.0 -0.761 4.397 CSV PDB
7.5 -0.7359 4.3411 CSV PDB
8.0 -0.7026 4.2874 CSV PDB
8.5 -0.6633 4.239 CSV PDB
9.0 -0.6186 4.2009 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH