Utomilumab / 6a3w

A4DAB286_6a3w_A_B | Source PDB: 6a3w | Chains: A, B | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.5564
Max Score
1.5695
Min Score
-3.512
Total Score
-122.97
Score CDR
-0.187
Score non-CDR
-0.6509

Calculation Parameters

Chain Sequence(s) EVQLVQSGAEVKKPGESLRISCKGSGYSFSTYWISWVRQMPGKGLEWMGKIYPGDSYTNYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARGYGIFDYWGQGTLVTVSSELTQPPSVSVSPGQTASITCSGDNIGDQYAHWYQQKPGQSPVLVIYQDKNRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCATYTGFGSLAVFGGGTKLTVL input.pdb
Selected Chain(s) A (Heavy), B (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.512
Maximum Score 1.5695
Average Score -0.5564
Total Score -122.9654

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E A -2.1063 Soluble
2 V A -1.1865 Soluble
3 Q A -1.3645 Soluble
4 L A 0.0000 Buried
5 V A 0.3746 Aggregation-prone
6 Q A 0.0000 Buried
7 S A -0.4669 Soluble
8 G A -0.4204 Soluble
9 A A 0.2917 Aggregation-prone
11 E A 0.2088 Aggregation-prone
12 V A 1.1315 Aggregation-prone
13 K A -0.9010 Soluble
14 K A -2.2776 Soluble
15 P A -2.1975 Soluble
16 G A -1.8201 Soluble
17 E A -1.7593 Soluble
18 S A -1.6258 Soluble
19 L A 0.0000 Buried
20 R A -2.1260 Soluble
21 I A 0.0000 Buried
22 S A -0.5856 Soluble
23 C A 0.0000 Buried
24 K A -0.8407 Soluble
25 G A 0.0000 Buried
26 S A -0.7882 Soluble
27 G A -1.1756 Soluble
28 Y A -0.4662 Soluble
29 S A -0.3165 Soluble
30 F A 0.0000 Buried
35 S A -0.8486 Soluble
36 T A -0.1126 Soluble
37 Y A 0.8772 Aggregation-prone
38 W A 0.9993 Aggregation-prone
39 I A 0.0000 Buried
40 S A 0.0000 Buried
41 W A 0.0000 Buried
42 V A 0.0000 Buried
43 R A -0.7340 Soluble
44 Q A -0.8282 Soluble
45 M A -0.7581 Soluble
46 P A -0.8884 Soluble
47 G A -1.4106 Soluble
48 K A -2.2172 Soluble
49 G A -1.4466 Soluble
50 L A 0.0000 Buried
51 E A -0.9519 Soluble
52 W A 0.0000 Buried
53 M A 0.0000 Buried
54 G A 0.0000 Buried
55 K A 0.0000 Buried
56 I A 0.0000 Buried
57 Y A 0.3464 Aggregation-prone
58 P A 0.0000 Buried
59 G A -1.1796 Soluble
62 D A -1.7714 Soluble
63 S A -0.7017 Soluble
64 Y A 0.7594 Aggregation-prone
65 T A 0.4212 Aggregation-prone
66 N A -0.0173 Soluble
67 Y A -0.5863 Soluble
68 S A -0.5294 Soluble
69 P A -0.9435 Soluble
70 S A -0.9654 Soluble
71 F A 0.0000 Buried
72 Q A -1.8719 Soluble
74 G A -1.6002 Soluble
75 Q A -1.7816 Soluble
76 V A 0.0000 Buried
77 T A -0.9017 Soluble
78 I A 0.0000 Buried
79 S A -0.4512 Soluble
80 A A -0.9529 Soluble
81 D A -1.7274 Soluble
82 K A -2.2337 Soluble
83 S A -0.6985 Soluble
84 I A 0.1947 Aggregation-prone
85 S A -0.7698 Soluble
86 T A 0.0000 Buried
87 A A 0.0000 Buried
88 Y A -0.7313 Soluble
89 L A 0.0000 Buried
90 Q A -1.4399 Soluble
91 W A 0.0000 Buried
92 S A -1.2549 Soluble
93 S A -1.5545 Soluble
94 L A 0.0000 Buried
95 K A -2.4244 Soluble
96 A A -1.3937 Soluble
97 S A -0.6878 Soluble
98 D A 0.0000 Buried
99 T A -0.1162 Soluble
100 A A 0.0000 Buried
101 M A 0.2865 Aggregation-prone
102 Y A 0.0000 Buried
103 Y A 0.0000 Buried
104 C A 0.0000 Buried
105 A A 0.0000 Buried
106 R A 0.0000 Buried
107 G A 0.6834 Aggregation-prone
108 Y A 1.2734 Aggregation-prone
109 G A 0.0000 Buried
114 I A 0.8383 Aggregation-prone
115 F A 0.0000 Buried
116 D A -0.5145 Soluble
117 Y A -0.1778 Soluble
118 W A -0.1302 Soluble
119 G A 0.0000 Buried
120 Q A -1.1915 Soluble
121 G A -0.5063 Soluble
122 T A 0.0000 Buried
123 L A 0.8007 Aggregation-prone
124 V A 0.0000 Buried
125 T A 0.1502 Aggregation-prone
126 V A 0.0000 Buried
127 S A -0.9202 Soluble
128 S A -1.1837 Soluble
3 E B -2.0936 Soluble
4 L B 0.0000 Buried
5 T B -0.7633 Soluble
6 Q B 0.0000 Buried
7 P B -0.5150 Soluble
8 P B -0.8306 Soluble
9 S B -0.7928 Soluble
11 V B -0.4290 Soluble
12 S B -0.3128 Soluble
13 V B 0.0000 Buried
14 S B -0.2699 Soluble
15 P B -0.6795 Soluble
16 G B -1.4442 Soluble
17 Q B -1.7493 Soluble
18 T B -1.0515 Soluble
19 A B -0.5401 Soluble
21 I B 0.0000 Buried
22 T B -0.1334 Soluble
23 C B 0.0000 Buried
24 S B -1.5310 Soluble
25 G B -2.3288 Soluble
26 D B -3.5120 Soluble
27 N B -3.5049 Soluble
28 I B 0.0000 Buried
29 G B -2.3933 Soluble
36 D B -2.6817 Soluble
37 Q B -0.8980 Soluble
38 Y B 0.5493 Aggregation-prone
39 A B 0.0000 Buried
40 H B 0.0000 Buried
41 W B 0.0000 Buried
42 Y B 0.0000 Buried
43 Q B -0.1997 Soluble
44 Q B 0.0000 Buried
45 K B -1.2916 Soluble
46 P B -1.2798 Soluble
47 G B -1.4759 Soluble
48 Q B -1.7462 Soluble
49 S B -0.7920 Soluble
50 P B 0.0000 Buried
51 V B 1.1327 Aggregation-prone
52 L B 0.7239 Aggregation-prone
53 V B 0.0000 Buried
54 I B 0.0000 Buried
55 Y B -0.4534 Soluble
56 Q B -0.5585 Soluble
57 D B -1.1598 Soluble
65 K B -2.2619 Soluble
66 N B -1.8794 Soluble
67 R B -1.8572 Soluble
68 P B -1.1048 Soluble
69 S B -0.8835 Soluble
70 G B -0.8446 Soluble
71 I B -0.5806 Soluble
72 P B -1.2082 Soluble
74 E B -2.2037 Soluble
75 R B -1.4234 Soluble
76 F B 0.0000 Buried
77 S B -1.3561 Soluble
78 G B -1.2850 Soluble
79 S B -1.1791 Soluble
80 N B -1.4236 Soluble
83 S B -1.6184 Soluble
84 G B -2.3570 Soluble
85 N B -3.0476 Soluble
86 T B -1.5528 Soluble
87 A B 0.0000 Buried
88 T B -0.4852 Soluble
89 L B 0.0000 Buried
90 T B -0.2548 Soluble
91 I B 0.0000 Buried
92 S B -1.1295 Soluble
93 G B -1.1515 Soluble
94 T B 0.0000 Buried
95 Q B -0.6949 Soluble
96 A B 0.1511 Aggregation-prone
97 M B 0.5158 Aggregation-prone
98 D B 0.0000 Buried
99 E B -0.9274 Soluble
100 A B 0.0000 Buried
101 D B -1.3218 Soluble
102 Y B 0.0000 Buried
103 Y B 0.0000 Buried
104 C B 0.0000 Buried
105 A B 0.0000 Buried
106 T B 0.0000 Buried
107 Y B 1.1655 Aggregation-prone
108 T B 0.6590 Aggregation-prone
109 G B 0.4351 Aggregation-prone
110 F B 1.5695 Aggregation-prone
113 G B 0.4187 Aggregation-prone
114 S B 0.4855 Aggregation-prone
115 L B 0.7368 Aggregation-prone
116 A B 0.0000 Buried
117 V B 0.0916 Aggregation-prone
118 F B 0.0000 Buried
119 G B 0.0000 Buried
120 G B -1.1530 Soluble
121 G B -1.1030 Soluble
122 T B 0.0000 Buried
123 K B -1.8095 Soluble
124 L B 0.0000 Buried
125 T B -0.4612 Soluble
126 V B 0.0000 Buried
127 L B 1.2644 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.4369 4.2477 CSV PDB
4.5 -0.4723 4.2477 CSV PDB
5.0 -0.5122 4.2477 CSV PDB
5.5 -0.5488 4.2477 CSV PDB
6.0 -0.5734 4.2477 CSV PDB
6.5 -0.5797 4.2477 CSV PDB
7.0 -0.5681 4.2477 CSV PDB
7.5 -0.5446 4.2477 CSV PDB
8.0 -0.5137 4.2477 CSV PDB
8.5 -0.4767 4.2477 CSV PDB
9.0 -0.434 4.2477 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH