Teropavimab / 7pc2

A4DAB261_7pc2_K_L | Source PDB: 7pc2 | Chains: K, L | Done
99.55
Yes
10 Å
Yes
Avg A4D Score
-0.804
Max Score
1.4968
Min Score
-3.0683
Total Score
-176.08
Score CDR
-0.7513
Score non-CDR
-0.8155

Calculation Parameters

Chain Sequence(s) QVQLLQSGAAVTKPGASVRVSCEASGYNIRDYFIHWWRQAPGQGLQWVGWINPKTGQPNNPRQFQGRVSLTRHASWDFDTYSFYMDLKALRSDDTAVYFCARQRSDYWDFDVWGSGTQVTVDIQMTQSPSSLSASVGDTVTITCQANGYLNWYQQRRGKAPKLLIYDGSKLERGVPSRFSGRRWGQEYNLTINNLQPEDIATYFCQVYEFVVPGTRLDL input.pdb
Selected Chain(s) K (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.0683
Maximum Score 1.4968
Average Score -0.804
Total Score -176.0808

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q K -1.2119 Soluble
2 V K -0.4301 Soluble
3 Q K -0.5735 Soluble
4 L K 0.0000 Buried
5 L K 0.6983 Aggregation-prone
6 Q K 0.0131 Aggregation-prone
7 S K -0.5624 Soluble
8 G K -0.7417 Soluble
9 A K -0.1946 Soluble
11 A K 0.4734 Aggregation-prone
12 V K 1.4968 Aggregation-prone
13 T K 0.1729 Aggregation-prone
14 K K -1.6694 Soluble
15 P K -1.5935 Soluble
16 G K -1.6855 Soluble
17 A K -1.3343 Soluble
18 S K -1.5430 Soluble
19 V K -0.8087 Soluble
20 R K -1.9152 Soluble
21 V K -0.8565 Soluble
22 S K -0.4639 Soluble
23 C K 0.0000 Buried
24 E K -0.6223 Soluble
25 A K 0.0000 Buried
26 S K -0.9777 Soluble
27 G K -1.1837 Soluble
28 Y K -1.3774 Soluble
29 N K -2.2964 Soluble
30 I K 0.0000 Buried
35 R K -2.8352 Soluble
36 D K -2.8094 Soluble
37 Y K -1.1325 Soluble
38 F K -0.2516 Soluble
39 I K 0.0000 Buried
40 H K 0.0000 Buried
41 W K 0.0000 Buried
42 W K 0.0000 Buried
43 R K -0.6221 Soluble
44 Q K -0.8801 Soluble
45 A K -1.1853 Soluble
46 P K -0.8573 Soluble
47 G K -1.4277 Soluble
48 Q K -1.7210 Soluble
49 G K -0.9038 Soluble
50 L K -0.4730 Soluble
51 Q K -0.6254 Soluble
52 W K -0.0753 Soluble
53 V K 0.0000 Buried
54 G K 0.0000 Buried
55 W K -0.2014 Soluble
56 I K 0.0000 Buried
57 N K -1.4140 Soluble
58 P K 0.0000 Buried
59 K K -2.6313 Soluble
62 T K -1.5886 Soluble
63 G K -1.5351 Soluble
64 Q K -1.8096 Soluble
65 P K -1.1630 Soluble
66 N K -1.5201 Soluble
67 N K -1.6804 Soluble
68 P K -1.9097 Soluble
69 R K -3.0555 Soluble
70 Q K -2.6168 Soluble
71 F K 0.0000 Buried
72 Q K -2.6897 Soluble
74 G K -1.9593 Soluble
75 R K -1.8488 Soluble
76 V K -1.5022 Soluble
77 S K -1.1414 Soluble
78 L K 0.0000 Buried
79 T K -0.7357 Soluble
80 R K -1.3946 Soluble
81 H K -1.1401 Soluble
82 A K -0.5528 Soluble
83 S K -0.1632 Soluble
84 W K 0.5334 Aggregation-prone
85 D K -0.9340 Soluble
85A F K 0.1355 Aggregation-prone
85B D K -1.6927 Soluble
85C T K -0.9795 Soluble
85D Y K 0.0000 Buried
86 S K -0.6488 Soluble
87 F K 0.0000 Buried
88 Y K -0.5729 Soluble
89 M K 0.0000 Buried
90 D K -1.3583 Soluble
91 L K 0.0000 Buried
92 K K -2.4799 Soluble
93 A K -1.6052 Soluble
94 L K 0.0000 Buried
95 R K -2.9774 Soluble
96 S K -2.0999 Soluble
97 D K -2.3769 Soluble
98 D K 0.0000 Buried
99 T K -0.8047 Soluble
100 A K 0.0000 Buried
101 V K -0.5038 Soluble
102 Y K 0.0000 Buried
103 F K 0.0000 Buried
104 C K 0.0000 Buried
105 A K 0.0000 Buried
106 R K 0.0000 Buried
107 Q K -0.5372 Soluble
108 R K -0.9753 Soluble
109 S K -1.0340 Soluble
110 D K -1.5829 Soluble
112 Y K -0.2423 Soluble
113 W K 0.0000 Buried
114 D K 0.0000 Buried
115 F K 0.0000 Buried
116 D K -0.7187 Soluble
117 V K -0.2609 Soluble
118 W K -0.2400 Soluble
119 G K 0.0000 Buried
120 S K -0.6433 Soluble
121 G K -0.7071 Soluble
122 T K 0.0000 Buried
123 Q K -0.9511 Soluble
124 V K 0.0000 Buried
125 T K -0.0631 Soluble
126 V K -0.1265 Soluble
1 D L -1.9482 Soluble
2 I L -0.9885 Soluble
3 Q L -1.5427 Soluble
4 M L -0.7104 Soluble
5 T L -0.7969 Soluble
6 Q L -0.7374 Soluble
7 S L -0.5487 Soluble
8 P L -0.5352 Soluble
9 S L -0.7353 Soluble
10 S L -1.0772 Soluble
11 L L -0.5361 Soluble
12 S L -0.5931 Soluble
13 A L -0.3012 Soluble
14 S L 0.3795 Aggregation-prone
15 V L 0.5870 Aggregation-prone
16 G L -1.1723 Soluble
17 D L -2.2424 Soluble
18 T L -1.7383 Soluble
19 V L 0.0000 Buried
20 T L -0.3118 Soluble
21 I L 0.0000 Buried
22 T L -1.1048 Soluble
23 C L 0.0000 Buried
24 Q L -2.1844 Soluble
25 A L 0.0000 Buried
27 N L -1.7496 Soluble
28 G L -0.7411 Soluble
38 Y L 0.8348 Aggregation-prone
39 L L 0.0000 Buried
40 N L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L 0.0000 Buried
44 Q L 0.0000 Buried
45 R L -2.8345 Soluble
46 R L -3.0683 Soluble
47 G L -2.4154 Soluble
48 K L -2.9644 Soluble
49 A L -1.6619 Soluble
50 P L 0.0000 Buried
51 K L -1.6152 Soluble
52 L L 0.0000 Buried
53 L L 0.0000 Buried
54 I L 0.0000 Buried
55 Y L -0.2582 Soluble
56 D L -0.7027 Soluble
57 G L 0.0000 Buried
65 S L -1.8783 Soluble
66 K L -1.7746 Soluble
67 L L -0.7837 Soluble
68 E L -1.4047 Soluble
69 R L -2.1251 Soluble
70 G L -1.2671 Soluble
71 V L -0.5826 Soluble
72 P L -0.5693 Soluble
74 S L -0.7327 Soluble
75 R L -1.3213 Soluble
76 F L 0.0000 Buried
77 S L -1.1031 Soluble
78 G L -1.8304 Soluble
79 R L -3.0410 Soluble
80 R L -3.0408 Soluble
83 W L -0.9343 Soluble
84 G L -1.1868 Soluble
85 Q L -2.3514 Soluble
86 E L -2.6647 Soluble
87 Y L 0.0000 Buried
88 N L -1.7321 Soluble
89 L L 0.0000 Buried
90 T L -0.8051 Soluble
91 I L 0.0000 Buried
92 N L -2.6093 Soluble
93 N L -2.4616 Soluble
94 L L 0.0000 Buried
95 Q L -1.1646 Soluble
96 P L -0.7758 Soluble
97 E L -1.6627 Soluble
98 D L 0.0000 Buried
99 I L -0.7613 Soluble
100 A L -1.5163 Soluble
101 T L -1.2022 Soluble
102 Y L 0.0000 Buried
103 F L 0.0000 Buried
104 C L 0.0000 Buried
105 Q L 0.0000 Buried
106 V L 0.0000 Buried
116 Y L 0.9717 Aggregation-prone
117 E L 0.3976 Aggregation-prone
118 F L 0.9470 Aggregation-prone
119 V L 0.6872 Aggregation-prone
120 V L 0.1180 Aggregation-prone
121 P L -0.7994 Soluble
122 G L -0.8345 Soluble
123 T L 0.0000 Buried
124 R L -2.3448 Soluble
125 L L 0.0000 Buried
126 D L -1.2126 Soluble
127 L L 0.9745 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6608 4.3246 CSV PDB
4.5 -0.7035 4.0988 CSV PDB
5.0 -0.7558 3.841 CSV PDB
5.5 -0.8091 3.5691 CSV PDB
6.0 -0.8549 3.2924 CSV PDB
6.5 -0.8882 3.0146 CSV PDB
7.0 -0.9099 2.7378 CSV PDB
7.5 -0.9248 2.466 CSV PDB
8.0 -0.9355 2.2085 CSV PDB
8.5 -0.9415 2.109 CSV PDB
9.0 -0.9395 2.2061 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH