Maftivimab / 7tn9

A4DAB164_7tn9_M_N | Source PDB: 7tn9 | Chains: M, N | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.4843
Max Score
1.4057
Min Score
-2.8021
Total Score
-105.59
Score CDR
-0.0429
Score non-CDR
-0.596

Calculation Parameters

Chain Sequence(s) VQLVESGGGLVQPGGSLRLSCAASGFTSSSYAMNWVRQAPGKGLEWVSTISGMGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKRGYPHSFDIWGQGTMVTVDIQMTQSPSSLSASVGDRVTITCRASQSISSFLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTLTFGQGTRL input.pdb
Selected Chain(s) M (Heavy), N (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.8021
Maximum Score 1.4057
Average Score -0.4843
Total Score -105.585

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 V M 1.3363 Aggregation-prone
3 Q M 0.1842 Aggregation-prone
4 L M 0.0000 Buried
5 V M 0.7309 Aggregation-prone
6 E M 0.0936 Aggregation-prone
7 S M -0.4157 Soluble
8 G M -0.6431 Soluble
9 G M -0.1777 Soluble
11 G M 0.6672 Aggregation-prone
12 L M 1.4057 Aggregation-prone
13 V M 0.1088 Aggregation-prone
14 Q M -1.1198 Soluble
15 P M -1.5424 Soluble
16 G M -1.4812 Soluble
17 G M -1.4001 Soluble
18 S M -1.4962 Soluble
19 L M -1.0200 Soluble
20 R M -1.9374 Soluble
21 L M 0.0000 Buried
22 S M -0.3838 Soluble
23 C M 0.0000 Buried
24 A M -0.1426 Soluble
25 A M -0.0814 Soluble
26 S M 0.1507 Aggregation-prone
27 G M 0.1223 Aggregation-prone
28 F M 0.4804 Aggregation-prone
29 T M -0.1524 Soluble
30 S M 0.0000 Buried
35 S M -0.3545 Soluble
36 S M 0.1856 Aggregation-prone
37 Y M 0.2380 Aggregation-prone
38 A M -0.2330 Soluble
39 M M 0.0000 Buried
40 N M 0.0000 Buried
41 W M 0.0000 Buried
42 V M 0.0000 Buried
43 R M 0.0000 Buried
44 Q M -0.7964 Soluble
45 A M -1.2734 Soluble
46 P M -0.8967 Soluble
47 G M -1.4371 Soluble
48 K M -2.3868 Soluble
49 G M -1.6846 Soluble
50 L M 0.0000 Buried
51 E M -1.5378 Soluble
52 W M -0.6771 Soluble
53 V M 0.0000 Buried
54 S M 0.0000 Buried
55 T M 0.0000 Buried
56 I M 0.0000 Buried
57 S M 0.0908 Aggregation-prone
58 G M 0.1271 Aggregation-prone
59 M M 0.5789 Aggregation-prone
62 G M -0.2278 Soluble
63 G M -0.2092 Soluble
64 S M 0.0906 Aggregation-prone
65 T M 0.3762 Aggregation-prone
66 Y M 0.8354 Aggregation-prone
67 Y M -0.3184 Soluble
68 A M 0.0000 Buried
69 D M -2.4043 Soluble
70 S M -1.6754 Soluble
71 V M 0.0000 Buried
72 K M -2.4655 Soluble
74 G M -1.8817 Soluble
75 R M -1.9470 Soluble
76 F M 0.0000 Buried
77 T M -0.8919 Soluble
78 I M 0.0000 Buried
79 S M -0.5146 Soluble
80 R M -0.9294 Soluble
81 D M -1.5246 Soluble
82 N M -1.3916 Soluble
83 S M -1.6127 Soluble
84 K M -2.3541 Soluble
85 N M -1.6711 Soluble
86 T M -1.0150 Soluble
87 L M 0.0000 Buried
88 Y M -0.6209 Soluble
89 L M 0.0000 Buried
90 Q M -1.5496 Soluble
91 M M 0.0000 Buried
92 N M -2.1693 Soluble
93 S M -1.6866 Soluble
94 L M 0.0000 Buried
95 R M -2.8021 Soluble
96 A M -1.8401 Soluble
97 E M -2.3150 Soluble
98 D M 0.0000 Buried
99 T M -0.4865 Soluble
100 A M 0.0000 Buried
101 V M 0.2141 Aggregation-prone
102 Y M 0.0000 Buried
103 Y M 0.0000 Buried
104 C M 0.0000 Buried
105 A M 0.0000 Buried
106 K M -0.7996 Soluble
107 R M -1.3077 Soluble
108 G M -0.2312 Soluble
109 Y M 1.0206 Aggregation-prone
110 P M 0.0000 Buried
113 H M -0.0848 Soluble
114 S M 0.0000 Buried
115 F M 0.0000 Buried
116 D M -0.7797 Soluble
117 I M -0.2354 Soluble
118 W M 0.0000 Buried
119 G M 0.0000 Buried
120 Q M -1.2922 Soluble
121 G M -0.6897 Soluble
122 T M -0.0386 Soluble
123 M M 0.5961 Aggregation-prone
124 V M 0.0000 Buried
125 T M 0.2345 Aggregation-prone
126 V M -0.3352 Soluble
1 D N -2.2091 Soluble
2 I N -1.5136 Soluble
3 Q N -2.0726 Soluble
4 M N 0.0000 Buried
5 T N -1.3198 Soluble
6 Q N 0.0000 Buried
7 S N -0.7715 Soluble
8 P N -0.4841 Soluble
9 S N -0.7361 Soluble
10 S N -0.5721 Soluble
11 L N -0.0594 Soluble
12 S N -0.1364 Soluble
13 A N -0.0937 Soluble
14 S N 0.0340 Aggregation-prone
15 V N 0.8076 Aggregation-prone
16 G N -0.5855 Soluble
17 D N -1.4762 Soluble
18 R N -2.1424 Soluble
19 V N 0.0000 Buried
20 T N -0.5841 Soluble
21 I N 0.0000 Buried
22 T N -0.6931 Soluble
23 C N 0.0000 Buried
24 R N -2.3369 Soluble
25 A N 0.0000 Buried
26 S N -1.8470 Soluble
27 Q N -2.0108 Soluble
28 S N -1.0701 Soluble
29 I N 0.0000 Buried
36 S N -0.1712 Soluble
37 S N -0.0726 Soluble
38 F N 0.9361 Aggregation-prone
39 L N 0.0000 Buried
40 N N 0.0000 Buried
41 W N 0.0000 Buried
42 Y N 0.0000 Buried
43 Q N 0.0000 Buried
44 Q N 0.0000 Buried
45 K N -1.6707 Soluble
46 P N -1.1923 Soluble
47 G N -1.5498 Soluble
48 K N -2.5715 Soluble
49 A N -1.6538 Soluble
50 P N 0.0000 Buried
51 K N -1.5614 Soluble
52 L N 0.0000 Buried
53 L N 0.0000 Buried
54 I N 0.0000 Buried
55 Y N 0.6227 Aggregation-prone
56 A N 0.4441 Aggregation-prone
57 A N 0.0000 Buried
65 S N -0.2895 Soluble
66 S N -0.0616 Soluble
67 L N 0.0621 Aggregation-prone
68 Q N -0.4003 Soluble
69 S N -0.4426 Soluble
70 G N -0.6222 Soluble
71 V N 0.0000 Buried
72 P N -0.4554 Soluble
74 S N -0.4910 Soluble
75 R N -0.5274 Soluble
76 F N 0.0000 Buried
77 S N -0.3251 Soluble
78 G N -0.3295 Soluble
79 S N -0.5626 Soluble
80 G N -0.7727 Soluble
83 S N -0.9523 Soluble
84 G N -1.0427 Soluble
85 T N -1.3745 Soluble
86 D N -1.6708 Soluble
87 F N 0.0000 Buried
88 T N -0.6420 Soluble
89 L N 0.0000 Buried
90 T N -0.6573 Soluble
91 I N 0.0000 Buried
92 S N -0.9975 Soluble
93 S N -0.8212 Soluble
94 L N 0.0000 Buried
95 Q N -0.7594 Soluble
96 P N -0.7555 Soluble
97 E N -1.6254 Soluble
98 D N 0.0000 Buried
99 F N -0.1636 Soluble
100 A N 0.0000 Buried
101 T N -0.4293 Soluble
102 Y N 0.0000 Buried
103 Y N 0.0000 Buried
104 C N 0.0000 Buried
105 Q N 0.0000 Buried
106 Q N 0.0000 Buried
107 S N 0.8745 Aggregation-prone
108 Y N 1.1601 Aggregation-prone
114 S N 0.2848 Aggregation-prone
115 T N -0.2609 Soluble
116 L N 0.2175 Aggregation-prone
117 T N -0.6247 Soluble
118 F N 0.0000 Buried
119 G N 0.0000 Buried
120 Q N -1.6791 Soluble
121 G N -1.2490 Soluble
122 T N 0.0000 Buried
123 R N -1.0099 Soluble
124 L N -0.1740 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.5997 2.1989 CSV PDB
4.5 -0.6265 2.1989 CSV PDB
5.0 -0.6557 2.1989 CSV PDB
5.5 -0.6822 2.1989 CSV PDB
6.0 -0.7009 2.1989 CSV PDB
6.5 -0.7083 2.1989 CSV PDB
7.0 -0.7057 2.1989 CSV PDB
7.5 -0.6968 2.1989 CSV PDB
8.0 -0.6843 2.1989 CSV PDB
8.5 -0.668 2.1989 CSV PDB
9.0 -0.6472 2.1989 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH