Porgaviximab / 5kel

A4DAB211_5kel_P_T | Source PDB: 5kel | Chains: P, T | Done
100
Yes
10 Å
Yes
Avg A4D Score
-0.6709
Max Score
2.0051
Min Score
-2.9075
Total Score
-152.3
Score CDR
-0.4363
Score non-CDR
-0.7339

Calculation Parameters

Chain Sequence(s) EVQLQESGGGLMQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKRSVYLQMNTLRAEDTGIYYCTRGNGNYRAMDYWGQGTSVTVSDIQMTQSPASLSVSVGETVSITCRASENIYSSLAWYQQKQGKSPQLLVYSATILADGVPSRFSGSGSGTQYSLKINSLQSEDFGTYYCQHFWGTPYTFGGGTKLEIK input.pdb
Selected Chain(s) P (Heavy), T (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -2.9075
Maximum Score 2.0051
Average Score -0.6709
Total Score -152.3018

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 E P -2.0512 Soluble
2 V P -1.2997 Soluble
3 Q P -1.7864 Soluble
4 L P 0.0000 Buried
5 Q P -1.5889 Soluble
6 E P -1.1166 Soluble
7 S P -0.9607 Soluble
8 G P -0.9480 Soluble
9 G P -0.5755 Soluble
11 G P 0.2937 Aggregation-prone
12 L P 1.1302 Aggregation-prone
13 M P -0.0609 Soluble
14 Q P -1.3095 Soluble
15 P P -1.6750 Soluble
16 G P -1.6731 Soluble
17 G P -1.2580 Soluble
18 S P -1.4507 Soluble
19 M P -1.1600 Soluble
20 K P -2.0217 Soluble
21 L P 0.0000 Buried
22 S P -0.6744 Soluble
23 C P 0.0000 Buried
24 V P -0.4206 Soluble
25 A P 0.0000 Buried
26 S P -1.2199 Soluble
27 G P -1.1576 Soluble
28 F P -0.8377 Soluble
29 T P -0.6599 Soluble
30 F P 0.0000 Buried
35 S P -1.2067 Soluble
36 N P -1.5782 Soluble
37 Y P 0.0000 Buried
38 W P -0.5452 Soluble
39 M P 0.0000 Buried
40 N P 0.0000 Buried
41 W P 0.0000 Buried
42 V P 0.0000 Buried
43 R P 0.0000 Buried
44 Q P -0.9236 Soluble
45 S P -1.6276 Soluble
46 P P -1.6796 Soluble
47 E P -2.8788 Soluble
48 K P -2.9075 Soluble
49 G P -1.7017 Soluble
50 L P 0.0000 Buried
51 E P -0.6733 Soluble
52 W P 0.0000 Buried
53 V P 0.0000 Buried
54 A P 0.0000 Buried
55 E P 0.0000 Buried
56 I P 0.0000 Buried
57 R P -0.8494 Soluble
58 L P -1.3375 Soluble
59 K P -2.2549 Soluble
60 S P -1.7155 Soluble
61 N P -1.8131 Soluble
62 N P -2.0328 Soluble
63 Y P -0.9043 Soluble
64 A P -0.7019 Soluble
65 T P -0.3055 Soluble
66 H P -0.9918 Soluble
67 Y P -1.3360 Soluble
68 A P -1.6398 Soluble
69 E P -2.7008 Soluble
70 S P -1.6896 Soluble
71 V P 0.0000 Buried
72 K P -2.8968 Soluble
74 G P -1.9601 Soluble
75 R P -1.9429 Soluble
76 F P 0.0000 Buried
77 T P -0.8933 Soluble
78 I P -0.1784 Soluble
79 S P -0.2532 Soluble
80 R P -0.6386 Soluble
81 D P -1.4249 Soluble
82 D P -1.8473 Soluble
83 S P -1.7005 Soluble
84 K P -2.3638 Soluble
85 R P -1.8801 Soluble
86 S P -1.0757 Soluble
87 V P 0.0000 Buried
88 Y P -0.3089 Soluble
89 L P 0.0000 Buried
90 Q P -1.2982 Soluble
91 M P 0.0000 Buried
92 N P -1.8929 Soluble
93 T P -1.6171 Soluble
94 L P 0.0000 Buried
95 R P -2.7808 Soluble
96 A P -2.0116 Soluble
97 E P -2.1917 Soluble
98 D P 0.0000 Buried
99 T P -0.3295 Soluble
100 G P 0.0000 Buried
101 I P 0.1513 Aggregation-prone
102 Y P 0.0000 Buried
103 Y P 0.0000 Buried
104 C P 0.0000 Buried
105 T P 0.0000 Buried
106 R P 0.0000 Buried
107 G P 0.0000 Buried
108 N P -1.3138 Soluble
109 G P -1.3559 Soluble
110 N P -1.4940 Soluble
112 Y P -0.5488 Soluble
113 R P -0.8478 Soluble
114 A P 0.0000 Buried
115 M P 0.0000 Buried
116 D P -0.4845 Soluble
117 Y P -0.0587 Soluble
118 W P -0.0999 Soluble
119 G P 0.0000 Buried
120 Q P -1.6297 Soluble
121 G P -0.9844 Soluble
122 T P -0.6628 Soluble
123 S P -0.0654 Soluble
124 V P 0.0000 Buried
125 T P -0.0394 Soluble
126 V P -0.6023 Soluble
127 S P -0.6854 Soluble
1 D T -1.9809 Soluble
2 I T -1.5365 Soluble
3 Q T -1.8422 Soluble
4 M T -1.1405 Soluble
5 T T -0.6705 Soluble
6 Q T 0.0000 Buried
7 S T -0.5420 Soluble
8 P T -0.3636 Soluble
9 A T -0.4544 Soluble
10 S T -0.5473 Soluble
11 L T -0.2214 Soluble
12 S T -0.3108 Soluble
13 V T 0.0000 Buried
14 S T 0.3608 Aggregation-prone
15 V T 1.2027 Aggregation-prone
16 G T -0.1566 Soluble
17 E T -0.4231 Soluble
18 T T -0.8274 Soluble
19 V T 0.0000 Buried
20 S T -0.7279 Soluble
21 I T 0.0000 Buried
22 T T -0.6873 Soluble
23 C T 0.0000 Buried
24 R T -1.8202 Soluble
25 A T -1.5886 Soluble
26 S T -1.6820 Soluble
27 E T -1.7634 Soluble
28 N T 0.0000 Buried
29 I T 1.8390 Aggregation-prone
36 Y T 1.3841 Aggregation-prone
37 S T 0.5698 Aggregation-prone
38 S T 0.0000 Buried
39 L T 0.0000 Buried
40 A T 0.0000 Buried
41 W T 0.0000 Buried
42 Y T 0.0000 Buried
43 Q T 0.0000 Buried
44 Q T -1.2620 Soluble
45 K T -1.8750 Soluble
46 Q T -1.9844 Soluble
47 G T -1.7794 Soluble
48 K T -2.0006 Soluble
49 S T -1.2706 Soluble
50 P T 0.0000 Buried
51 Q T -0.7633 Soluble
52 L T 0.0000 Buried
53 L T 0.0000 Buried
54 V T 0.0000 Buried
55 Y T 0.5425 Aggregation-prone
56 S T 0.5495 Aggregation-prone
57 A T 0.4812 Aggregation-prone
65 T T 0.8768 Aggregation-prone
66 I T 2.0051 Aggregation-prone
67 L T 0.8475 Aggregation-prone
68 A T 0.0000 Buried
69 D T -1.6122 Soluble
70 G T -1.2129 Soluble
71 V T -0.5915 Soluble
72 P T -0.6240 Soluble
74 S T -0.5549 Soluble
75 R T -1.1150 Soluble
76 F T 0.0000 Buried
77 S T -0.5392 Soluble
78 G T -0.3423 Soluble
79 S T -0.8323 Soluble
80 G T -1.1436 Soluble
83 S T -0.7153 Soluble
84 G T -0.7149 Soluble
85 T T -1.6195 Soluble
86 Q T -2.0657 Soluble
87 Y T 0.0000 Buried
88 S T -0.9016 Soluble
89 L T 0.0000 Buried
90 K T -1.3732 Soluble
91 I T 0.0000 Buried
92 N T -1.8400 Soluble
93 S T -1.0122 Soluble
94 L T 0.0000 Buried
95 Q T -1.1141 Soluble
96 S T -0.7867 Soluble
97 E T -2.1293 Soluble
98 D T 0.0000 Buried
99 F T -0.6317 Soluble
100 G T -1.2146 Soluble
101 T T -0.9753 Soluble
102 Y T 0.0000 Buried
103 Y T 0.0000 Buried
104 C T 0.0000 Buried
105 Q T 0.0000 Buried
106 H T 0.0000 Buried
107 F T 0.0000 Buried
108 W T 0.6875 Aggregation-prone
109 G T 0.0092 Aggregation-prone
114 T T -0.3086 Soluble
115 P T -0.6462 Soluble
116 Y T -0.2069 Soluble
117 T T -0.4093 Soluble
118 F T -0.1127 Soluble
119 G T 0.0000 Buried
120 G T -1.0339 Soluble
121 G T -0.8148 Soluble
122 T T 0.0000 Buried
123 K T -1.3343 Soluble
124 L T 0.0000 Buried
125 E T -0.4707 Soluble
126 I T 0.9332 Aggregation-prone
127 K T -0.6844 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6547 3.1923 CSV PDB
4.5 -0.6889 3.1454 CSV PDB
5.0 -0.7307 3.0938 CSV PDB
5.5 -0.7706 3.0406 CSV PDB
6.0 -0.7971 2.9868 CSV PDB
6.5 -0.8015 2.933 CSV PDB
7.0 -0.7837 2.8794 CSV PDB
7.5 -0.7505 2.827 CSV PDB
8.0 -0.709 2.7776 CSV PDB
8.5 -0.6627 2.736 CSV PDB
9.0 -0.6129 2.7076 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH