Teropavimab / 5v8m

A4DAB261_5v8m_H_L | Source PDB: 5v8m | Chains: H, L | Done
99.55
Yes
10 Å
Yes
Avg A4D Score
-0.7384
Max Score
1.5389
Min Score
-3.4412
Total Score
-161.71
Score CDR
-0.7672
Score non-CDR
-0.7321

Calculation Parameters

Chain Sequence(s) QVQLLQSGAAVTKPGASVRVSCEASGYNIRDYFIHWWRQAPGQGLQWVGWINPKTGQPNNPRQFQGRVSLTRHASWDFDTYSFYMDLKALRSDDTAVYFCARQRSDYWDFDVWGSGTQVTVDIQMTQSPSSLSASVGDTVTITCQANGYLNWYQQRRGKAPKLLIYDGSKLERGVPSRFSGRRWGQEYNLTINNLQPEDIATYFCQVYEFVVPGTRLDL input.pdb
Selected Chain(s) H (Heavy), L (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.4412
Maximum Score 1.5389
Average Score -0.7384
Total Score -161.7088

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q H -1.2306 Soluble
2 V H -0.4227 Soluble
3 Q H -0.5744 Soluble
4 L H 0.0000 Buried
5 L H 0.7434 Aggregation-prone
6 Q H 0.0290 Aggregation-prone
7 S H -0.3966 Soluble
8 G H -0.4592 Soluble
9 A H 0.0982 Aggregation-prone
11 A H 0.6112 Aggregation-prone
12 V H 1.5389 Aggregation-prone
13 T H -0.1068 Soluble
14 K H -1.7190 Soluble
15 P H -1.6316 Soluble
16 G H -1.7302 Soluble
17 A H -1.1753 Soluble
18 S H -1.6298 Soluble
19 V H -1.0818 Soluble
20 R H -2.0688 Soluble
21 V H 0.0000 Buried
22 S H -0.4884 Soluble
23 C H 0.0000 Buried
24 E H -0.3199 Soluble
25 A H 0.0000 Buried
26 S H -0.8782 Soluble
27 G H -1.1390 Soluble
28 Y H -1.3541 Soluble
29 N H -2.0134 Soluble
30 I H 0.0000 Buried
35 R H -3.4412 Soluble
36 D H -3.0751 Soluble
37 Y H -1.6609 Soluble
38 F H -0.7270 Soluble
39 I H 0.0000 Buried
40 H H 0.0000 Buried
41 W H 0.0000 Buried
42 W H 0.0000 Buried
43 R H -0.4284 Soluble
44 Q H -0.7004 Soluble
45 A H -1.0661 Soluble
46 P H -1.1621 Soluble
47 G H -1.4820 Soluble
48 Q H -1.7668 Soluble
49 G H -1.0913 Soluble
50 L H -0.4573 Soluble
51 Q H -0.4289 Soluble
52 W H 0.0459 Aggregation-prone
53 V H 0.0000 Buried
54 G H 0.0000 Buried
55 W H -0.3175 Soluble
56 I H 0.0000 Buried
57 N H -1.6101 Soluble
58 P H 0.0000 Buried
59 K H -2.9385 Soluble
62 T H -1.6676 Soluble
63 G H -1.4771 Soluble
64 Q H -1.5772 Soluble
65 P H -1.0727 Soluble
66 N H -1.4156 Soluble
67 N H -1.7339 Soluble
68 P H -1.9750 Soluble
69 R H -3.0759 Soluble
70 Q H -2.6549 Soluble
71 F H 0.0000 Buried
72 Q H -2.7357 Soluble
74 G H -2.0107 Soluble
75 R H -1.9016 Soluble
76 V H 0.0000 Buried
77 S H -1.1693 Soluble
78 L H 0.0000 Buried
79 T H -0.7599 Soluble
80 R H -1.5057 Soluble
81 H H -1.0933 Soluble
82 A H -0.3745 Soluble
83 S H 0.0300 Aggregation-prone
84 W H 0.5319 Aggregation-prone
85 D H -0.8494 Soluble
85A F H 0.3620 Aggregation-prone
85B D H -1.3739 Soluble
85C T H -0.8523 Soluble
85D Y H -0.7128 Soluble
86 S H -0.5549 Soluble
87 F H 0.0000 Buried
88 Y H -0.6552 Soluble
89 M H 0.0000 Buried
90 D H -1.4893 Soluble
91 L H 0.0000 Buried
92 K H -2.3498 Soluble
93 A H -1.8248 Soluble
94 L H 0.0000 Buried
95 R H -2.8670 Soluble
96 S H -2.1635 Soluble
97 D H -2.4354 Soluble
98 D H 0.0000 Buried
99 T H -0.7153 Soluble
100 A H 0.0000 Buried
101 V H -0.1651 Soluble
102 Y H 0.0000 Buried
103 F H 0.0000 Buried
104 C H 0.0000 Buried
105 A H 0.0000 Buried
106 R H 0.0000 Buried
107 Q H -0.5531 Soluble
108 R H -0.8105 Soluble
109 S H -1.1152 Soluble
110 D H -1.4506 Soluble
112 Y H -0.2408 Soluble
113 W H 0.0000 Buried
114 D H 0.0000 Buried
115 F H 0.0000 Buried
116 D H 0.0000 Buried
117 V H 0.0000 Buried
118 W H 0.0000 Buried
119 G H 0.0000 Buried
120 S H -0.7101 Soluble
121 G H -0.4908 Soluble
122 T H 0.0000 Buried
123 Q H -0.0625 Soluble
124 V H 0.0000 Buried
125 T H 0.1385 Aggregation-prone
126 V H -0.3968 Soluble
1 D L -1.9826 Soluble
2 I L -0.9659 Soluble
3 Q L -1.4856 Soluble
4 M L -0.7490 Soluble
5 T L -0.7787 Soluble
6 Q L -0.6552 Soluble
7 S L -0.5372 Soluble
8 P L 0.0000 Buried
9 S L -0.5557 Soluble
10 S L -0.5401 Soluble
11 L L -0.0884 Soluble
12 S L 0.1573 Aggregation-prone
13 A L 0.1224 Aggregation-prone
14 S L 0.0791 Aggregation-prone
15 V L 0.1015 Aggregation-prone
16 G L -0.9969 Soluble
17 D L -1.3301 Soluble
18 T L -1.4639 Soluble
19 V L 0.0000 Buried
20 T L -0.4234 Soluble
21 I L 0.0000 Buried
22 T L -0.7973 Soluble
23 C L 0.0000 Buried
24 Q L -1.7502 Soluble
25 A L 0.0000 Buried
27 N L -1.8726 Soluble
28 G L -0.7485 Soluble
38 Y L 0.3638 Aggregation-prone
39 L L 0.0000 Buried
40 N L 0.0000 Buried
41 W L 0.0000 Buried
42 Y L 0.0000 Buried
43 Q L -0.9800 Soluble
44 Q L 0.0000 Buried
45 R L -2.4591 Soluble
46 R L -3.0368 Soluble
47 G L -2.3988 Soluble
48 K L -2.9437 Soluble
49 A L -1.7111 Soluble
50 P L 0.0000 Buried
51 K L -1.6513 Soluble
52 L L 0.0000 Buried
53 L L 0.0000 Buried
54 I L 0.0000 Buried
55 Y L -0.2331 Soluble
56 D L -0.4996 Soluble
57 G L 0.0000 Buried
65 S L -1.7161 Soluble
66 K L -2.0241 Soluble
67 L L -0.8781 Soluble
68 E L 0.0000 Buried
69 R L -2.0786 Soluble
70 G L -1.2129 Soluble
71 V L -0.7393 Soluble
72 P L -0.6799 Soluble
74 S L -0.7497 Soluble
75 R L -1.3696 Soluble
76 F L 0.0000 Buried
77 S L -1.1565 Soluble
78 G L -1.7597 Soluble
79 R L -2.9135 Soluble
80 R L -2.4067 Soluble
83 W L -0.8228 Soluble
84 G L -1.3313 Soluble
85 Q L -1.9394 Soluble
86 E L -2.1058 Soluble
87 Y L 0.0000 Buried
88 N L -1.5338 Soluble
89 L L 0.0000 Buried
90 T L -0.9895 Soluble
91 I L 0.0000 Buried
92 N L -2.3320 Soluble
93 N L -2.1663 Soluble
94 L L 0.0000 Buried
95 Q L -1.3701 Soluble
96 P L -0.9966 Soluble
97 E L -1.8216 Soluble
98 D L 0.0000 Buried
99 I L -0.4652 Soluble
100 A L 0.0000 Buried
101 T L -1.0053 Soluble
102 Y L 0.0000 Buried
103 F L 0.0000 Buried
104 C L 0.0000 Buried
105 Q L 0.0000 Buried
106 V L 0.0000 Buried
116 Y L 0.8894 Aggregation-prone
117 E L 0.4786 Aggregation-prone
118 F L 1.1068 Aggregation-prone
119 V L 0.5706 Aggregation-prone
120 V L 0.0000 Buried
121 P L -0.6800 Soluble
122 G L -0.9630 Soluble
123 T L 0.0000 Buried
124 R L -1.0500 Soluble
125 L L 0.0000 Buried
126 D L -0.1940 Soluble
127 L L 1.1920 Aggregation-prone

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6209 4.9858 CSV PDB
4.5 -0.659 4.714 CSV PDB
5.0 -0.7035 4.376 CSV PDB
5.5 -0.7474 3.9957 CSV PDB
6.0 -0.7831 3.6038 CSV PDB
6.5 -0.8062 3.2128 CSV PDB
7.0 -0.8182 2.876 CSV PDB
7.5 -0.8236 2.6164 CSV PDB
8.0 -0.8246 2.5942 CSV PDB
8.5 -0.8199 2.5918 CSV PDB
9.0 -0.8072 2.5904 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH