Matuzumab / 3c09

A4DAB167_3c09_C_B | Source PDB: 3c09 | Chains: C, B | Done
99.56
Yes
10 Å
Yes
Avg A4D Score
-0.5982
Max Score
2.3357
Min Score
-3.402
Total Score
-218.96
Score CDR
-0.4253
Score non-CDR
-0.6237

Calculation Parameters

Chain Sequence(s) QVQLVQSGAEVKKPGASVKVSCKASGYTFTSHWMHWVRQAPGQGLEWIGEFNPSNGRTNYNEKFKSKATMTVDTSTNTAYMELSSLRSEDTAVYYCASRDYDYAGRYFDYWGQGTLVTVSSASTKGPSGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVYICNVNHKPSNTKVDKKDIQMTQSPSSLSASVGDRVTITCSASSSVTYMYWYQQKPGKAPKLLIYDTSNLASGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSHIFTFGQGTKVEIKRTVAAPSVFIFPPSDEQLTASVVCLLNNFYPREGNSQESVTEQDSKDSTYSLSSTLTVTHQGLSSPVTK input.pdb
Selected Chain(s) C (Heavy), B (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.402
Maximum Score 2.3357
Average Score -0.5982
Total Score -218.9591

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
1 Q C -1.5245 Soluble
2 V C -0.8808 Soluble
3 Q C -1.4962 Soluble
4 L C 0.0000 Buried
5 V C -0.4189 Soluble
6 Q C 0.0000 Buried
7 S C -0.7427 Soluble
8 G C -1.0730 Soluble
9 A C -0.8177 Soluble
11 E C -1.1680 Soluble
12 V C -0.6882 Soluble
13 K C -1.5183 Soluble
14 K C -2.2880 Soluble
15 P C -1.8842 Soluble
16 G C -1.3396 Soluble
17 A C -0.9927 Soluble
18 S C -1.1961 Soluble
19 V C -1.1631 Soluble
20 K C -2.1404 Soluble
21 V C 0.0000 Buried
22 S C -0.7111 Soluble
23 C C 0.0000 Buried
24 K C -1.3488 Soluble
25 A C -1.0940 Soluble
26 S C -1.0729 Soluble
27 G C -1.0108 Soluble
28 Y C -0.4776 Soluble
29 T C -0.1934 Soluble
30 F C 0.0000 Buried
35 T C -0.4696 Soluble
36 S C -0.1005 Soluble
37 H C 0.0000 Buried
38 W C -0.0842 Soluble
39 M C 0.0000 Buried
40 H C 0.0000 Buried
41 W C 0.0000 Buried
42 V C 0.0000 Buried
43 R C 0.0000 Buried
44 Q C -0.7259 Soluble
45 A C -0.9897 Soluble
46 P C -0.8093 Soluble
47 G C -1.2971 Soluble
48 Q C -1.8985 Soluble
49 G C -1.4748 Soluble
50 L C 0.0000 Buried
51 E C -1.2417 Soluble
52 W C 0.0000 Buried
53 I C 0.0000 Buried
54 G C 0.0000 Buried
55 E C 0.0000 Buried
56 F C -0.5145 Soluble
57 N C -1.0745 Soluble
58 P C 0.0000 Buried
59 S C -1.1874 Soluble
62 N C -2.0365 Soluble
63 G C -1.7162 Soluble
64 R C -2.3670 Soluble
65 T C -1.2352 Soluble
66 N C -1.1626 Soluble
67 Y C -1.4660 Soluble
68 N C -2.2785 Soluble
69 E C -3.4020 Soluble
70 K C -3.2299 Soluble
71 F C 0.0000 Buried
72 K C -3.0660 Soluble
74 S C -1.8551 Soluble
75 K C -1.8636 Soluble
76 A C 0.0000 Buried
77 T C -1.0263 Soluble
78 M C 0.0000 Buried
79 T C -0.3766 Soluble
80 V C -0.3735 Soluble
81 D C -0.9853 Soluble
82 T C -0.7249 Soluble
83 S C -0.6501 Soluble
84 T C -0.8475 Soluble
85 N C -1.1632 Soluble
86 T C 0.0000 Buried
87 A C 0.0000 Buried
88 Y C -0.6735 Soluble
89 M C 0.0000 Buried
90 E C -1.8153 Soluble
91 L C 0.0000 Buried
92 S C -1.0784 Soluble
93 S C -1.0947 Soluble
94 L C 0.0000 Buried
95 R C -2.3274 Soluble
96 S C -2.0559 Soluble
97 E C -2.3742 Soluble
98 D C -1.5424 Soluble
99 T C -0.8835 Soluble
100 A C 0.0000 Buried
101 V C 0.1773 Aggregation-prone
102 Y C 0.0000 Buried
103 Y C 0.0000 Buried
104 C C 0.0000 Buried
105 A C 0.0000 Buried
106 S C 0.0000 Buried
107 R C 0.0000 Buried
108 D C 0.0207 Aggregation-prone
109 Y C 0.0970 Aggregation-prone
110 D C -0.1990 Soluble
111 Y C 0.8233 Aggregation-prone
112A A C 0.0957 Aggregation-prone
112 G C -0.4656 Soluble
113 R C -1.0474 Soluble
114 Y C -0.3936 Soluble
115 F C 0.0083 Aggregation-prone
116 D C -0.0272 Soluble
117 Y C 0.3201 Aggregation-prone
118 W C -0.3397 Soluble
119 G C 0.0000 Buried
120 Q C -1.5578 Soluble
121 G C -0.7124 Soluble
122 T C 0.0000 Buried
123 L C -0.1026 Soluble
124 V C 0.0000 Buried
125 T C -0.8086 Soluble
126 V C 0.0000 Buried
127 S C -1.0098 Soluble
128 S C -0.9458 Soluble
129 A C -0.6037 Soluble
130 S C -0.7132 Soluble
131 T C -0.7045 Soluble
132 K C -1.3874 Soluble
133 G C -1.4665 Soluble
134 P C -0.7824 Soluble
135 S C -0.8139 Soluble
136 G C -0.1748 Soluble
137 C C -0.4332 Soluble
138 L C 0.0753 Aggregation-prone
139 V C 0.0000 Buried
140 K C -0.6557 Soluble
141 D C -0.9991 Soluble
142 Y C 0.0000 Buried
143 F C 0.0000 Buried
144 P C 0.0000 Buried
145 E C -0.6082 Soluble
146 P C -0.5729 Soluble
147 V C -0.4503 Soluble
148 T C -0.4514 Soluble
149 V C -0.0818 Soluble
150 S C -0.3527 Soluble
151 W C 0.0000 Buried
152 N C -0.3694 Soluble
153 S C -0.3606 Soluble
154 G C -0.6072 Soluble
155 A C -0.2572 Soluble
156 L C 0.2468 Aggregation-prone
157 T C -0.0485 Soluble
158 S C -0.0409 Soluble
159 G C 0.3043 Aggregation-prone
160 V C 0.5926 Aggregation-prone
161 H C -0.0521 Soluble
162 T C 0.1164 Aggregation-prone
163 F C 0.0000 Buried
164 P C -0.2749 Soluble
165 A C 0.2851 Aggregation-prone
166 V C 0.5214 Aggregation-prone
167 L C 1.4210 Aggregation-prone
168 Q C 0.1879 Aggregation-prone
169 S C -0.0676 Soluble
170 S C -0.2713 Soluble
171 G C -0.0061 Soluble
172 L C -0.0515 Soluble
173 Y C 0.3390 Aggregation-prone
174 S C 0.1803 Aggregation-prone
175 L C 0.0000 Buried
176 S C 0.0343 Aggregation-prone
177 S C 0.0000 Buried
178 V C 0.6703 Aggregation-prone
179 V C 0.8777 Aggregation-prone
180 T C 0.9431 Aggregation-prone
181 V C 2.0009 Aggregation-prone
182 Y C 0.7900 Aggregation-prone
183 I C -0.5933 Soluble
184 C C 0.0000 Buried
185 N C -1.5675 Soluble
186 V C 0.0000 Buried
187 N C 0.0000 Buried
188 H C 0.0000 Buried
189 K C -2.7442 Soluble
190 P C -1.7082 Soluble
191 S C -1.8381 Soluble
192 N C -2.3747 Soluble
193 T C -2.0137 Soluble
194 K C -2.3460 Soluble
195 V C -1.2855 Soluble
196 D C -2.4496 Soluble
197 K C -2.4451 Soluble
198 K C -2.1951 Soluble
1 D B -2.1140 Soluble
2 I B 0.0000 Buried
3 Q B -1.7500 Soluble
4 M B 0.0000 Buried
5 T B -0.9426 Soluble
6 Q B 0.0000 Buried
7 S B -0.5073 Soluble
8 P B -0.6989 Soluble
9 S B -0.9930 Soluble
10 S B -1.0126 Soluble
11 L B -0.7609 Soluble
12 S B -1.0133 Soluble
13 A B 0.0000 Buried
14 S B -1.1093 Soluble
15 V B -0.3340 Soluble
16 G B -0.8304 Soluble
17 D B -1.5177 Soluble
18 R B -2.2247 Soluble
19 V B 0.0000 Buried
20 T B -0.5631 Soluble
21 I B 0.0000 Buried
22 T B -0.5490 Soluble
23 C B 0.0000 Buried
24 S B -1.1736 Soluble
25 A B 0.0000 Buried
26 S B -1.2292 Soluble
27 S B -0.8948 Soluble
28 S B -0.7416 Soluble
29 V B -0.3057 Soluble
37 T B 0.0088 Aggregation-prone
38 Y B 0.3835 Aggregation-prone
39 M B 0.0000 Buried
40 Y B 0.0000 Buried
41 W B 0.0000 Buried
42 Y B 0.0000 Buried
43 Q B 0.0000 Buried
44 Q B -1.3578 Soluble
45 K B -1.8747 Soluble
46 P B -1.5901 Soluble
47 G B -1.8595 Soluble
48 K B -2.5068 Soluble
49 A B -1.5815 Soluble
50 P B 0.0000 Buried
51 K B -1.5044 Soluble
52 L B 0.0000 Buried
53 L B 0.0000 Buried
54 I B 0.0000 Buried
55 Y B 0.0000 Buried
56 D B -0.8236 Soluble
57 T B -0.6338 Soluble
65 S B -0.7779 Soluble
66 N B -1.0091 Soluble
67 L B -0.3157 Soluble
68 A B -0.5089 Soluble
69 S B -0.4414 Soluble
70 G B -0.4496 Soluble
71 V B -0.1297 Soluble
72 P B -0.3262 Soluble
74 S B -0.4233 Soluble
75 R B -0.8496 Soluble
76 F B 0.0000 Buried
77 S B -0.3866 Soluble
78 G B 0.0000 Buried
79 S B -0.8469 Soluble
80 G B -1.1221 Soluble
83 S B -1.0254 Soluble
84 G B -0.9614 Soluble
85 T B -1.2863 Soluble
86 D B -2.1191 Soluble
87 Y B 0.0000 Buried
88 T B -0.6631 Soluble
89 F B 0.0000 Buried
90 T B -0.5743 Soluble
91 I B 0.0000 Buried
92 S B -1.4015 Soluble
93 S B -1.1696 Soluble
94 L B 0.0000 Buried
95 Q B -1.0010 Soluble
96 P B -1.6695 Soluble
97 E B -1.9839 Soluble
98 D B 0.0000 Buried
99 I B 0.0000 Buried
100 A B 0.0000 Buried
101 T B -1.1579 Soluble
102 Y B 0.0000 Buried
103 Y B 0.0000 Buried
104 C B 0.0000 Buried
105 Q B 0.0000 Buried
106 Q B 0.0000 Buried
107 W B 0.2012 Aggregation-prone
108 S B 0.0000 Buried
109 S B -0.7130 Soluble
114 H B -0.9897 Soluble
115 I B -0.7773 Soluble
116 F B 0.0000 Buried
117 T B -0.6899 Soluble
118 F B 0.0000 Buried
119 G B 0.0000 Buried
120 Q B -1.8078 Soluble
121 G B 0.0000 Buried
122 T B 0.0000 Buried
123 K B -2.1029 Soluble
124 V B 0.0000 Buried
125 E B -1.7603 Soluble
126 I B 0.0000 Buried
127 K B -1.8190 Soluble
128 R B -1.1557 Soluble
129 T B 0.0019 Aggregation-prone
130 V B 0.9930 Aggregation-prone
131 A B 0.3328 Aggregation-prone
132 A B 0.0351 Aggregation-prone
133 P B 0.0000 Buried
134 S B 0.0945 Aggregation-prone
135 V B 1.0238 Aggregation-prone
136 F B 2.3357 Aggregation-prone
137 I B 1.6273 Aggregation-prone
138 F B 1.2346 Aggregation-prone
139 P B 0.6214 Aggregation-prone
140 P B -0.3242 Soluble
141 S B -1.1474 Soluble
142 D B -2.5959 Soluble
143 E B -2.8691 Soluble
144 Q B -1.8541 Soluble
145 L B -0.2523 Soluble
146 T B 0.0052 Aggregation-prone
147 A B 0.3932 Aggregation-prone
148 S B 0.0000 Buried
149 V B 1.0477 Aggregation-prone
150 V B 0.0000 Buried
151 C B 1.0261 Aggregation-prone
152 L B 0.0000 Buried
153 L B 0.8118 Aggregation-prone
154 N B 0.0646 Aggregation-prone
155 N B -0.6434 Soluble
156 F B 0.0000 Buried
157 Y B 0.0000 Buried
158 P B -1.7089 Soluble
159 R B -3.0030 Soluble
160 E B -2.9315 Soluble
161 G B -1.0749 Soluble
162 N B -1.4160 Soluble
163 S B -1.2475 Soluble
164 Q B -1.2902 Soluble
165 E B -1.7585 Soluble
166 S B -0.8884 Soluble
167 V B -0.6805 Soluble
168 T B -1.0991 Soluble
169 E B -2.2694 Soluble
170 Q B 0.0000 Buried
171 D B -2.0542 Soluble
172 S B -2.2411 Soluble
173 K B -2.5136 Soluble
174 D B -1.7452 Soluble
175 S B 0.0000 Buried
176 T B 0.0000 Buried
177 Y B 0.0000 Buried
178 S B 0.0000 Buried
179 L B -0.7366 Soluble
180 S B 0.0000 Buried
181 S B -0.6316 Soluble
182 T B -0.1663 Soluble
183 L B 0.4315 Aggregation-prone
184 T B 0.0389 Aggregation-prone
185 V B 0.7527 Aggregation-prone
186 T B -0.2303 Soluble
187 H B -0.9474 Soluble
188 Q B -1.5373 Soluble
189 G B -0.2691 Soluble
190 L B -0.1171 Soluble
191 S B -0.5253 Soluble
192 S B -0.3859 Soluble
193 P B -0.1804 Soluble
194 V B -0.0807 Soluble
195 T B -0.2195 Soluble
196 K B -0.8943 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6861 4.2929 CSV PDB
4.5 -0.7261 4.2966 CSV PDB
5.0 -0.7725 4.3073 CSV PDB
5.5 -0.8154 4.3351 CSV PDB
6.0 -0.8426 4.392 CSV PDB
6.5 -0.8456 4.4785 CSV PDB
7.0 -0.8251 4.5826 CSV PDB
7.5 -0.7896 4.694 CSV PDB
8.0 -0.7462 4.8077 CSV PDB
8.5 -0.6968 4.9217 CSV PDB
9.0 -0.6417 5.034 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH