Apitegromab / 6umx

A4DAB023_6umx_h_l | Source PDB: 6umx | Chains: h, l | Done
95.75
Yes
10 Å
Yes
Avg A4D Score
-0.6673
Max Score
2.8982
Min Score
-3.1778
Total Score
-290.26
Score CDR
-0.0871
Score non-CDR
-0.753

Calculation Parameters

Chain Sequence(s) IQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSRKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDLLVRFLYWSHYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPVLTQPPSASGTPGQRVTISCSGSSSNIGSNPVHWYQQLPGTAPKLLIYDDNQRPSGVPDRFSGSKSGTSASLVISGLQSDDEADYYCAAWDDSLNSVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT input.pdb
Selected Chain(s) h (Heavy), l (Light)
Distance of Aggregation 10 Å
FoldX Energy Minimization Yes
pH Calculations Yes
Downloads Download all data (.tar.gz)

Aggrescan4D Profile

Aggregation-prone (score > 0)
Soluble (score < 0)
Buried (score = 0)

Per-Residue A4D Scores

Download CSV
Minimum Score -3.1778
Maximum Score 2.8982
Average Score -0.6673
Total Score -290.2607

Residues with A4D score > 0.0 are highlighted as aggregation-prone.

Index Residue Chain A4D Score Classification
2 I h 1.3123 Aggregation-prone
3 Q h 0.1004 Aggregation-prone
4 L h 0.0000 Buried
5 V h 0.8724 Aggregation-prone
6 Q h 0.0000 Buried
7 S h -0.4948 Soluble
8 G h -1.0466 Soluble
9 G h -0.7307 Soluble
11 G h -0.2415 Soluble
12 V h 0.1823 Aggregation-prone
13 V h 0.0000 Buried
14 Q h -2.0854 Soluble
15 P h -2.2169 Soluble
16 G h -2.2334 Soluble
17 R h -2.8661 Soluble
18 S h -2.0130 Soluble
19 L h -1.4855 Soluble
20 R h -2.0494 Soluble
21 L h 0.0000 Buried
22 S h -0.3460 Soluble
23 C h 0.0000 Buried
24 A h -0.2177 Soluble
25 A h 0.0000 Buried
26 S h 0.0088 Aggregation-prone
27 G h 0.2191 Aggregation-prone
28 F h 0.2386 Aggregation-prone
29 T h 0.0402 Aggregation-prone
30 F h 0.0000 Buried
35 S h -0.6268 Soluble
36 S h 0.0000 Buried
37 Y h 0.3694 Aggregation-prone
38 G h 0.0000 Buried
39 M h 0.0000 Buried
40 H h 0.0000 Buried
41 W h 0.0000 Buried
42 V h 0.0000 Buried
43 R h 0.0000 Buried
44 Q h -0.8743 Soluble
45 A h -1.2610 Soluble
46 P h -0.9815 Soluble
47 G h -1.4643 Soluble
48 K h -2.2612 Soluble
49 G h -1.4594 Soluble
50 L h 0.0000 Buried
51 E h -0.8057 Soluble
52 W h 0.0000 Buried
53 V h 0.0000 Buried
54 A h 0.0000 Buried
55 V h 0.0000 Buried
56 I h 0.0000 Buried
57 S h 0.0000 Buried
58 Y h -0.5826 Soluble
59 D h -1.8973 Soluble
62 G h -1.5428 Soluble
63 S h -1.3700 Soluble
64 R h -1.7825 Soluble
65 K h -1.0528 Soluble
66 Y h -0.4489 Soluble
67 Y h -0.7433 Soluble
68 A h -1.2149 Soluble
69 D h -2.3596 Soluble
70 S h -1.7620 Soluble
71 V h 0.0000 Buried
72 K h -2.5751 Soluble
74 G h -1.7276 Soluble
75 R h -1.3690 Soluble
76 F h 0.0000 Buried
77 T h -0.7941 Soluble
78 I h 0.0000 Buried
79 S h -0.7243 Soluble
80 R h -1.1353 Soluble
81 D h -1.7861 Soluble
82 N h -1.9313 Soluble
83 S h -1.6851 Soluble
84 K h -2.4388 Soluble
85 N h -1.8935 Soluble
86 T h -1.0201 Soluble
87 L h 0.0000 Buried
88 Y h -0.3300 Soluble
89 L h 0.0000 Buried
90 Q h -1.0549 Soluble
91 M h 0.0000 Buried
92 N h -1.8434 Soluble
93 S h -1.7866 Soluble
94 L h 0.0000 Buried
95 R h -2.5399 Soluble
96 A h -1.7208 Soluble
97 E h -2.2188 Soluble
98 D h 0.0000 Buried
99 T h -0.7607 Soluble
100 A h 0.0000 Buried
101 V h 0.0398 Aggregation-prone
102 Y h 0.0000 Buried
103 Y h 0.0000 Buried
104 C h 0.0000 Buried
105 A h 0.0000 Buried
106 R h 0.0000 Buried
107 D h 0.0000 Buried
108 L h 0.2787 Aggregation-prone
109 L h 1.2256 Aggregation-prone
110 V h 1.5705 Aggregation-prone
111 R h 1.3532 Aggregation-prone
111A F h 2.8392 Aggregation-prone
111B L h 2.8982 Aggregation-prone
111C Y h 2.6251 Aggregation-prone
112C W h 1.8366 Aggregation-prone
112B S h 0.0000 Buried
112A H h 0.6473 Aggregation-prone
112 Y h 0.3488 Aggregation-prone
113 Y h 0.2819 Aggregation-prone
114 G h 0.0000 Buried
115 M h 0.0000 Buried
116 D h -0.6764 Soluble
117 V h -0.0667 Soluble
118 W h 0.0000 Buried
119 G h 0.0000 Buried
120 Q h -1.0423 Soluble
121 G h -0.4663 Soluble
122 T h -0.2829 Soluble
123 T h -0.0768 Soluble
124 V h 0.0000 Buried
125 T h -0.4766 Soluble
126 V h 0.0000 Buried
127 S h -0.7933 Soluble
128 S h -0.6528 Soluble
129 A h -0.4653 Soluble
130 S h -0.5618 Soluble
131 T h -0.6341 Soluble
132 K h -1.1588 Soluble
133 G h -1.3905 Soluble
134 P h -0.6537 Soluble
135 S h -0.2643 Soluble
136 V h 0.0000 Buried
137 F h 0.0000 Buried
138 P h -0.8878 Soluble
139 L h 0.0000 Buried
140 A h -0.8094 Soluble
141 P h 0.0000 Buried
142 S h -1.1455 Soluble
143 S h -1.2528 Soluble
144 K h -2.0063 Soluble
145 S h -1.2890 Soluble
146 T h -0.7881 Soluble
147 S h -0.8435 Soluble
148 G h -1.0825 Soluble
149 G h -0.9099 Soluble
150 T h -0.6014 Soluble
151 A h 0.0000 Buried
152 A h -0.1422 Soluble
153 L h 0.0000 Buried
154 G h 0.0000 Buried
155 C h 0.0000 Buried
156 L h 0.0000 Buried
157 V h 0.0000 Buried
158 K h 0.0000 Buried
159 D h -0.4815 Soluble
160 Y h 0.0000 Buried
161 F h 0.0000 Buried
162 P h -0.8448 Soluble
163 E h -1.0499 Soluble
164 P h -1.1716 Soluble
165 V h -0.9900 Soluble
166 T h -0.7832 Soluble
167 V h -0.4201 Soluble
168 S h -0.4247 Soluble
169 W h 0.0000 Buried
170 N h -0.6796 Soluble
171 S h -0.6355 Soluble
172 G h -0.4812 Soluble
173 A h -0.2339 Soluble
174 L h -0.0268 Soluble
175 T h -0.2210 Soluble
176 S h -0.4382 Soluble
177 G h -0.5606 Soluble
178 V h -0.0132 Soluble
179 H h -0.4353 Soluble
180 T h -0.0376 Soluble
181 F h 0.0000 Buried
182 P h -0.0558 Soluble
183 A h -0.0300 Soluble
184 V h 0.0000 Buried
185 L h 0.6080 Aggregation-prone
186 Q h -0.1054 Soluble
187 S h -0.3276 Soluble
188 S h -0.2840 Soluble
189 G h -0.0858 Soluble
190 L h -0.1262 Soluble
191 Y h 0.0446 Aggregation-prone
192 S h 0.0000 Buried
193 L h 0.0000 Buried
194 S h 0.0000 Buried
195 S h 0.0000 Buried
196 V h 0.0000 Buried
197 V h 0.0000 Buried
198 T h -0.2382 Soluble
199 V h 0.0000 Buried
200 P h -0.5442 Soluble
201 S h -0.5735 Soluble
202 S h -0.6412 Soluble
203 S h -0.6472 Soluble
204 L h -0.7923 Soluble
205 G h -1.0669 Soluble
206 T h -1.0328 Soluble
207 Q h -1.5212 Soluble
208 T h -1.1892 Soluble
209 Y h 0.0000 Buried
210 I h -0.9007 Soluble
211 C h 0.0000 Buried
212 N h -1.5042 Soluble
213 V h 0.0000 Buried
214 N h -2.2719 Soluble
215 H h 0.0000 Buried
216 K h -2.8967 Soluble
217 P h -1.7571 Soluble
218 S h -1.8681 Soluble
219 N h -2.6331 Soluble
220 T h -2.1792 Soluble
221 K h -2.8244 Soluble
222 V h -1.5941 Soluble
223 D h -2.4480 Soluble
224 K h -1.7029 Soluble
225 K h -2.0187 Soluble
226 V h 0.0000 Buried
227 E h -2.4176 Soluble
228 P h -1.2370 Soluble
3 V l 1.5718 Aggregation-prone
4 L l 0.0000 Buried
5 T l 0.0638 Aggregation-prone
6 Q l 0.0000 Buried
7 P l -0.6693 Soluble
8 P l -0.9600 Soluble
9 S l -1.0524 Soluble
11 A l -0.7788 Soluble
12 S l -0.6853 Soluble
13 G l 0.0000 Buried
14 T l -0.8494 Soluble
15 P l -1.4318 Soluble
16 G l -1.5664 Soluble
17 Q l -2.1971 Soluble
18 R l -2.5037 Soluble
19 V l 0.0000 Buried
20 T l -0.3405 Soluble
21 I l 0.0000 Buried
22 S l -0.2547 Soluble
23 C l 0.0000 Buried
24 S l -0.1967 Soluble
25 G l -0.0915 Soluble
26 S l -0.2929 Soluble
27 S l -0.8299 Soluble
28 S l -1.0523 Soluble
29 N l 0.0000 Buried
30 I l 0.0000 Buried
35 G l -0.7821 Soluble
36 S l -0.7669 Soluble
37 N l 0.0000 Buried
38 P l -0.4662 Soluble
39 V l 0.0000 Buried
40 H l 0.0000 Buried
41 W l 0.0000 Buried
42 Y l 0.0000 Buried
43 Q l 0.0000 Buried
44 Q l 0.0000 Buried
45 L l -0.3297 Soluble
46 P l -0.5424 Soluble
47 G l -0.6329 Soluble
48 T l -0.5940 Soluble
49 A l -0.5735 Soluble
50 P l 0.0000 Buried
51 K l -1.1369 Soluble
52 L l 0.0000 Buried
53 L l 0.0000 Buried
54 I l 0.0000 Buried
55 Y l -1.1614 Soluble
56 D l -1.5220 Soluble
57 D l -1.7632 Soluble
65 N l -2.4679 Soluble
66 Q l -2.5389 Soluble
67 R l -2.0608 Soluble
68 P l -0.9775 Soluble
69 S l -0.7766 Soluble
70 G l -0.8305 Soluble
71 V l -1.1123 Soluble
72 P l -1.3470 Soluble
74 D l -2.3894 Soluble
75 R l -1.5535 Soluble
76 F l 0.0000 Buried
77 S l -1.3611 Soluble
78 G l -1.3426 Soluble
79 S l -1.2173 Soluble
80 K l -1.2460 Soluble
83 S l -0.8055 Soluble
84 G l -0.8904 Soluble
85 T l -0.7289 Soluble
86 S l -0.6644 Soluble
87 A l 0.0000 Buried
88 S l -0.4476 Soluble
89 L l 0.0000 Buried
90 V l -0.1154 Soluble
91 I l 0.0000 Buried
92 S l -1.6720 Soluble
93 G l -1.5997 Soluble
94 L l 0.0000 Buried
95 Q l -2.2835 Soluble
96 S l -1.8219 Soluble
97 D l -2.3849 Soluble
98 D l 0.0000 Buried
99 E l -1.5820 Soluble
100 A l 0.0000 Buried
101 D l 0.0000 Buried
102 Y l 0.0000 Buried
103 Y l 0.0000 Buried
104 C l 0.0000 Buried
105 A l 0.0000 Buried
106 A l 0.0000 Buried
107 W l 0.0000 Buried
108 D l -0.7321 Soluble
109 D l -1.6977 Soluble
113 S l -0.5806 Soluble
114 L l 0.2701 Aggregation-prone
115 N l -0.1765 Soluble
116 S l 0.0000 Buried
117 V l 0.5178 Aggregation-prone
118 F l 0.0000 Buried
119 G l 0.0000 Buried
120 G l -0.7349 Soluble
121 G l 0.0000 Buried
122 T l 0.0000 Buried
123 K l -2.0323 Soluble
124 L l 0.0000 Buried
125 T l -0.7638 Soluble
126 V l 0.0000 Buried
127 L l 0.0410 Aggregation-prone
128 G l -0.8796 Soluble
129 Q l -1.0983 Soluble
130 P l -1.2277 Soluble
131 K l -2.1645 Soluble
132 A l -1.3174 Soluble
133 A l -0.7928 Soluble
134 P l -0.4157 Soluble
135 S l -0.4222 Soluble
136 V l 0.0000 Buried
137 T l -0.6102 Soluble
138 L l 0.0000 Buried
139 F l 0.0000 Buried
140 P l -0.1592 Soluble
141 P l 0.0000 Buried
142 S l -0.9976 Soluble
143 S l -1.4262 Soluble
144 E l -2.4265 Soluble
145 E l 0.0000 Buried
146 L l -2.1314 Soluble
147 Q l -2.4106 Soluble
148 A l -2.0271 Soluble
149 N l -2.8080 Soluble
150 K l -2.8990 Soluble
151 A l 0.0000 Buried
152 T l 0.0000 Buried
153 L l 0.0000 Buried
154 V l 0.0000 Buried
155 C l 0.0000 Buried
156 L l 0.0000 Buried
157 I l 0.0000 Buried
158 S l -0.4936 Soluble
159 D l -1.5765 Soluble
160 F l 0.0000 Buried
161 Y l 0.0000 Buried
162 P l -0.9020 Soluble
163 G l -0.8918 Soluble
164 A l -0.1940 Soluble
165 V l -0.0706 Soluble
166 T l -0.0488 Soluble
167 V l -0.0368 Soluble
168 A l -0.5381 Soluble
169 W l 0.0000 Buried
170 K l -1.1424 Soluble
171 A l 0.0000 Buried
172 D l -1.2819 Soluble
173 S l -0.8988 Soluble
174 S l -0.5843 Soluble
175 P l -0.8155 Soluble
176 V l -0.7513 Soluble
177 K l -1.6791 Soluble
178 A l -0.8390 Soluble
179 G l -0.7731 Soluble
180 V l -0.6964 Soluble
181 E l -0.8553 Soluble
182 T l -0.2436 Soluble
183 T l 0.0000 Buried
184 T l -0.1527 Soluble
185 P l -0.5572 Soluble
186 S l -1.2534 Soluble
187 K l -2.6347 Soluble
188 Q l -2.1393 Soluble
189 S l -1.8310 Soluble
190 N l -2.5826 Soluble
191 N l -2.8815 Soluble
192 K l -2.4577 Soluble
193 Y l -1.5268 Soluble
194 A l 0.0000 Buried
195 A l 0.0000 Buried
196 S l 0.0000 Buried
197 S l 0.0000 Buried
198 Y l 0.0000 Buried
199 L l 0.0000 Buried
200 S l -0.6311 Soluble
201 L l -1.1794 Soluble
202 T l -1.8735 Soluble
203 P l -2.5129 Soluble
204 E l -3.1778 Soluble
205 Q l -2.2955 Soluble
206 W l 0.0000 Buried
207 K l -3.0955 Soluble
208 S l -2.4137 Soluble
209 H l -2.3390 Soluble
210 R l -2.5071 Soluble
211 S l -1.5437 Soluble
212 Y l 0.0000 Buried
213 S l -0.9831 Soluble
214 C l 0.0000 Buried
215 Q l -1.1516 Soluble
216 V l 0.0000 Buried
217 T l -0.7441 Soluble
218 H l 0.0000 Buried
219 E l -2.2982 Soluble
220 G l -1.3790 Soluble
221 S l -0.9150 Soluble
222 T l -0.8192 Soluble
223 V l -0.8320 Soluble
224 E l -2.1052 Soluble
225 K l -1.4826 Soluble
226 T l -0.8836 Soluble
227 V l 0.0000 Buried
228 A l -0.8991 Soluble
229 P l -1.0380 Soluble
230 T l -0.3449 Soluble

3D Structure — colored by A4D score

Sequence - click residue to focus in viewer  |  colored by A4D score
Load structure to view sequence…
Downloads
Color Legend (B-factor = A4D Score)
Score > 1.5 — highly aggregation-prone
Score 0.5–1.5 — aggregation-prone
Score ≈ 0 — buried
Score −1 to −0.5 — soluble
Score < −2.5 — highly soluble
pH Structure
Load structure at specific pH condition
A4D Score Threshold
Highlight residues > threshold in the sequence panel
CDR Regions
HCDR1
HCDR2
HCDR3
LCDR1
LCDR2
LCDR3
Display Options

pH-Dependent Aggregation Profiles

A4D scores calculated across 11 pH conditions (4.0–9.0, step 0.5). Click a row to view the structure at that pH. The input structure is globular — max score is recommended for pH analysis.

pH Avg A4D Score Max A4D Score Downloads
4.0 -0.6297 4.9701 CSV PDB
4.5 -0.6664 4.9701 CSV PDB
5.0 -0.7087 4.9701 CSV PDB
5.5 -0.7483 4.9701 CSV PDB
6.0 -0.7755 4.9701 CSV PDB
6.5 -0.7834 4.9701 CSV PDB
7.0 -0.772 4.9701 CSV PDB
7.5 -0.7475 4.97 CSV PDB
8.0 -0.7154 4.9699 CSV PDB
8.5 -0.6776 4.9694 CSV PDB
9.0 -0.6339 4.9678 CSV PDB
Average A4D Score vs pH
Max A4D Score vs pH